CD300C (NM_006678) Human Tagged ORF Clone

SKU
RC204678
CD300C (Myc-DDK-tagged)-Human CD300c molecule (CD300C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD300C
Synonyms CLM-6; CMRF-35; CMRF-35A; CMRF35; CMRF35-A1; CMRF35A; CMRF35A1; IGSF16; LIR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204678 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCCAGGGCCTGGGCCTCGTGGCGGTCTTCAGCTCTGCTCCTCCTGCTTGTCCCAGGCTATTTTC
CTCTGAGCCACCCCATGACCGTGGCGGGCCCCGTGGGGGGATCCCTGAGTGTGCAGTGTCGCTATGAGAA
GGAACACAGGACCCTCAACAAATTCTGGTGCAGACCACCACAGATTCTCCGATGTGACAAGATTGTGGAG
ACCAAAGGGTCAGCAGGGAAAAGGAATGGCCGAGTGTCCATCAGGGACAGTCCTGCAAACCTCAGCTTCA
CAGTGACCCTGGAGAATCTCACAGAGGAGGACGCAGGCACCTACTGGTGTGGGGTGGATACACCGTGGCT
CCGAGACTTTCATGATCCCATTGTCGAGGTTGAGGTGTCCGTGTTCCCGGCCGGGACGACCACAGCCTCC
AGCCCCCAGAGCTCCATGGGCACCTCAGGTCCTCCCACGAAGCTGCCCGTGCACACCTGGCCCAGCGTGA
CCAGAAAGGACAGCCCCGAACCCAGCCCACACCCTGGCTCCCTGTTCAGCAATGTCCGCTTCCTGCTCCT
GGTCCTCTTGGAGCTGCCCCTGCTCCTGAGCATGCTGGGTGCCGTCCTCTGGGTGAACAGACCTCAGAGA
AGCTCTAGAAGCAGGCAGAATTGGCCCAAGGGTGAGAACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204678 protein sequence
Red=Cloning site Green=Tags(s)

MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE
TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTAS
SPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQR
SSRSRQNWPKGENQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006678
ORF Size 672 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006678.5
RefSeq Size 1602 bp
RefSeq ORF 675 bp
Locus ID 10871
UniProt ID Q08708
Cytogenetics 17q25.1
Protein Families Druggable Genome, Transmembrane
MW 24.8 kDa
Summary The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CD300C (NM_006678) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204678L1 Lenti ORF clone of Human CD300c molecule (CD300C), Myc-DDK-tagged 10 ug
$750.00
RC204678L2 Lenti ORF clone of Human CD300c molecule (CD300C), mGFP tagged 10 ug
$750.00
RC204678L3 Lenti ORF clone of Human CD300c molecule (CD300C), Myc-DDK-tagged 10 ug
$750.00
RC204678L4 Lenti ORF clone of Human CD300c molecule (CD300C), mGFP tagged 10 ug
$750.00
RG204678 CD300C (tGFP-tagged) - Human CD300c molecule (CD300C) 10 ug
$650.00
SC122755 CD300C (untagged)-Human CD300c molecule (CD300C) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.