SLC35A1 (NM_006416) Human Tagged ORF Clone

SKU
RC204670
SLC35A1 (Myc-DDK-tagged)-Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLC35A1
Synonyms CDG2F; CMPST; CST; hCST
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204670 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCCCGAGAGACAATGTCACTTTATTATTCAAGTTATACTGCTTGGCAGTGATGACCCTGATGG
CTGCAGTCTATACCATAGCTTTAAGATACACAAGGACATCAGACAAAGAACTCTACTTTTCAACCACAGC
CGTGTGTATCACAGAAGTTATAAAGTTATTGCTAAGTGTGGGAATTTTAGCTAAAGAAACTGGTAGTCTG
GGTAGATTCAAAGCATCTTTAAGAGAAAATGTCTTGGGGAGCCCCAAGGAACTGTTGAAGTTAAGTGTGC
CATCGTTAGTGTATGCTGTTCAGAACAACATGGCTTTCCTAGCTCTTAGCAATCTGGATGCAGCAGTGTA
CCAGGTGACCTACCAGTTGAAGATTCCGTGTACTGCTTTATGCACTGTTTTAATGTTAAACCGGACACTC
AGCAAATTACAGTGGGTTTCAGTTTTTATGCTGTGTGCTGGAGTTACGCTTGTACAGTGGAAACCAGCCC
AAGCTACAAAAGTGGTGGTGGAACAAAATCCATTATTAGGGTTTGGCGCTATAGCTATTGCTGTATTGTG
CTCAGGATTTGCAGGAGTATATTTTGAAAAAGTTTTAAAGAGTTCAGATACTTCTCTTTGGGTGAGAAAC
ATTCAAATGTATCTATCAGGGATTATTGTGACATTAGCTGGCGTCTACTTGTCAGATGGAGCTGAAATTA
AAGAAAAAGGATTTTTCTATGGTTACACATATTATGTCTGGTTTGTCATCTTTCTTGCAAGTGTTGGTGG
CCTCTACACTTCTGTTGTGGTTAAGTACACAGACAACATCATGAAAGGCTTTTCTGCAGCAGCGGCCATT
GTCCTTTCCACCATTGCTTCAGTAATGCTGTTTGGATTACAGATAACACTCACCTTTGCCCTGGGTACTC
TTCTTGTATGTGTTTCCATATATCTCTATGGATTACCCAGACAAGACACTACATCCATCCAACAAGGAGA
AACAGCTTCAAAGGAGAGAGTTATTGGTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204670 protein sequence
Red=Cloning site Green=Tags(s)

MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSL
GRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTL
SKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRN
IQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAI
VLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006416
ORF Size 1011 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006416.5
RefSeq Size 1918 bp
RefSeq ORF 1014 bp
Locus ID 10559
UniProt ID P78382
Cytogenetics 6q15
Domains Nuc_sug_transp
Protein Families Transmembrane
MW 36.8 kDa
Summary The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]
Write Your Own Review
You're reviewing:SLC35A1 (NM_006416) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204670L1 Lenti ORF clone of Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204670L2 Lenti ORF clone of Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC204670L3 Lenti ORF clone of Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204670L4 Lenti ORF clone of Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG204670 SLC35A1 (tGFP-tagged) - Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC116104 SLC35A1 (untagged)-Human solute carrier family 35 (CMP-sialic acid transporter), member A1 (SLC35A1), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.