CYC1 (NM_001916) Human Tagged ORF Clone

SKU
RC204545
CYC1 (Myc-DDK-tagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CYC1
Synonyms MC3DN6; UQCR4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204545 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCAGCTGCGGCTTCGCTTCGCGGGGTAGTGTTGGGCCCGCGGGGCGCGGGGCTCCCGGGCGCGC
GTGCCCGGGGTCTGCTGTGCAGCGCGCGGCCCGGGCAGCTCCCGCTACGGACACCTCAGGCAGTGGCCTT
GTCGTCGAAGTCTGGCCTTTCCCGAGGCCGGAAAGTGATGCTGTCAGCGCTGGGCATGCTGGCGGCAGGG
GGTGCGGGGCTGGCCGTGGCTCTGCATTCGGCTGTGAGTGCCAGTGACCTGGAGCTGCACCCCCCCAGCT
ATCCGTGGTCTCACCGTGGCCTCCTCTCTTCCTTGGACCACACCAGCATCCGGAGGGGTTTCCAGGTATA
TAAGCAGGTGTGCGCCTCCTGCCACAGCATGGACTTCGTGGCCTACCGCCACCTGGTGGGCGTGTGCTAC
ACGGAGGATGAAGCTAAGGAGCTGGCTGCGGAGGTGGAGGTTCAAGACGGCCCCAATGAAGATGGGGAGA
TGTTCATGCGGCCAGGGAAGCTGTTCGACTATTTCCCAAAACCATACCCCAACAGTGAGGCTGCTCGAGC
TGCCAACAACGGAGCATTGCCCCCTGACCTCAGCTACATCGTGCGAGCTAGGCATGGTGGTGAGGACTAC
GTCTTCTCCCTGCTCACGGGCTACTGCGAGCCACCCACCGGGGTGTCACTGCGGGAAGGTCTCTACTTCA
ACCCCTACTTTCCTGGCCAGGCCATTGCCATGGCCCCTCCCATCTACACAGATGTCTTAGAGTTTGACGA
TGGCACCCCAGCTACCATGTCCCAGATAGCCAAGGATGTGTGCACCTTCCTGCGCTGGGCATCTGAGCCA
GAGCACGACCATCGAAAACGCATGGGGCTCAAGATGTTGATGATGATGGCTCTGCTGGTGCCCCTGGTCT
ACACCATAAAGCGGCACAAGTGGTCAGTCCTGAAGAGTCGGAAGCTGGCATATCGGCCGCCCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204545 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAG
GAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCY
TEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDY
VFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEP
EHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001916
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001916.2, NP_001907.2
RefSeq Size 1251 bp
RefSeq ORF 978 bp
Locus ID 1537
UniProt ID P08574
Cytogenetics 8q24.3
Domains Cytochrome_C1
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 35.4 kDa
Summary This gene encodes a subunit of the cytochrome bc1 complex, which plays an important role in the mitochondrial respiratory chain by transferring electrons from the Rieske iron-sulfur protein to cytochrome c. Mutations in this gene may cause mitochondrial complex III deficiency, nuclear type 6. [provided by RefSeq, Dec 2013]
Write Your Own Review
You're reviewing:CYC1 (NM_001916) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204545L1 Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC204545L2 Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC204545L3 Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC204545L4 Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG204545 CYC1 (tGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118940 CYC1 (untagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein 10 ug
$300.00
SC323737 CYC1 (untagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.