TIGAR (NM_020375) Human Tagged ORF Clone

SKU
RC204087
C12orf5 (Myc-DDK-tagged)-Human chromosome 12 open reading frame 5 (C12orf5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIGAR
Synonyms C12orf5; FR2BP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204087 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGCTTCGCTCTGACTGTTGTCCGGCATGGAGAAACAAGATTTAACAAGGAGAAAATAATCCAAG
GACAAGGAGTAGATGAACCTCTTTCAGAAACTGGATTTAAACAAGCAGCAGCTGCTGGTATATTTCTGAA
TAATGTGAAGTTTACTCATGCTTTCTCCAGTGATCTCATGAGGACAAAGCAGACCATGCATGGAATTTTG
GAGAGAAGCAAATTTTGCAAAGATATGACGGTAAAGTATGACTCAAGACTTCGGGAAAGGAAATACGGGG
TTGTAGAAGGCAAAGCGCTAAGTGAGCTGAGGGCCATGGCCAAAGCAGCCAGGGAAGAGTGCCCTGTGTT
TACACCGCCCGGAGGAGAGACGCTGGACCAGGTGAAAATGCGTGGAATAGACTTTTTTGAATTTCTTTGT
CAACTAATCCTGAAAGAAGCGGATCAAAAAGAACAGTTTTCCCAAGGATCTCCAAGCAACTGTCTGGAAA
CTTCTTTGGCAGAGATATTTCCTTTAGGAAAAAATCACAGCTCTAAAGTTAATTCAGACAGCGGTATTCC
AGGATTAGCAGCCAGTGTCTTAGTTGTGAGTCACGGTGCTTACATGAGAAGTCTGTTTGATTATTTTCTG
ACTGACCTTAAGTGTTCCTTACCAGCCACTCTGAGCAGATCTGAACTTATGTCAGTCACTCCCAATACAG
GGATGAGTCTCTTTATCATAAACTTTGAGGAAGGAAGAGAAGTTAAACCAACGGTTCAGTGTATTTGTAT
GAACCTACAGGATCATCTAAATGGACTGACTGAAACTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204087 protein sequence
Red=Cloning site Green=Tags(s)

MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL
ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC
QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL
TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020375
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020375.3
RefSeq Size 8237 bp
RefSeq ORF 813 bp
Locus ID 57103
UniProt ID Q9NQ88
Cytogenetics 12p13.32
Domains PGAM
MW 30.1 kDa
Summary This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TIGAR (NM_020375) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204087L1 Lenti ORF clone of Human chromosome 12 open reading frame 5 (C12orf5), Myc-DDK-tagged 10 ug
$600.00
RC204087L2 Lenti ORF clone of Human chromosome 12 open reading frame 5 (C12orf5), mGFP tagged 10 ug
$600.00
RC204087L3 Lenti ORF clone of Human chromosome 12 open reading frame 5 (C12orf5), Myc-DDK-tagged 10 ug
$600.00
RC204087L4 Lenti ORF clone of Human chromosome 12 open reading frame 5 (C12orf5), mGFP tagged 10 ug
$600.00
RG204087 C12orf5 (tGFP-tagged) - Human chromosome 12 open reading frame 5 (C12orf5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113108 C12orf5 (untagged)-Human chromosome 12 open reading frame 5 (C12orf5) 10 ug
$300.00
SC320794 C12orf5 (untagged)-Human chromosome 12 open reading frame 5 (C12orf5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.