NC2 alpha (DRAP1) (NM_006442) Human Tagged ORF Clone

SKU
RC204031
DRAP1 (Myc-DDK-tagged)-Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NC2 alpha
Synonyms NC2-alpha
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204031 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGCAAGAAGAAGAAGTACAACGCGCGGTTCCCGCCGGCGCGGATCAAGAAGATCATGCAGACGG
ACGAAGAGATTGGGAAGGTGGCGGCGGCGGTGCCTGTCATCATCTCCCGGGCGCTCGAGCTCTTCCTAGA
GTCGCTGTTGAAGAAGGCCTGCCAGGTGACCCAGTCGCGGAACGCGAAGACCATGACCACATCCCACCTG
AAGCAGTGCATCGAGCTGGAGCAGCAGTTTGACTTCTTGAAGGACCTGGTGGCATCTGTTCCCGACATGC
AGGGGGACGGGGAAGACAACCACATGGATGGGGACAAGGGCGCCCGCAGGGGCCGGAAGCCAGGCAGCGG
CGGCCGGAAGAACGGTGGGATGGGAACGAAAAGCAAGGACAAGAAGCTGTCCGGGACAGACTCGGAGCAG
GAGGATGAATCTGAGGACACAGATACTGATGGGGAAGAGGAGACATCACAACCCCCACCCCAGGCCAGCC
ACCCCTCTGCCCACTTTCAGAGCCCCCCGACACCCTTCCTGCCCTTCGCCTCTACTCTGCCTTTGCCCCC
AGCGCCCCCGGGCCCCTCAGCACCTGATGAAGAGGACGAAGAAGATTACGACTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204031 protein sequence
Red=Cloning site Green=Tags(s)

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHL
KQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQ
EDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006442
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006442.4
RefSeq Size 1022 bp
RefSeq ORF 618 bp
Locus ID 10589
UniProt ID Q14919
Cytogenetics 11q13.1
Protein Families Transcription Factors
MW 22.3 kDa
Summary Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NC2 alpha (DRAP1) (NM_006442) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204031L1 Lenti ORF clone of Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1), Myc-DDK-tagged 10 ug
$600.00
RC204031L2 Lenti ORF clone of Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1), mGFP tagged 10 ug
$600.00
RC204031L3 Lenti ORF clone of Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1), Myc-DDK-tagged 10 ug
$600.00
RC204031L4 Lenti ORF clone of Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1), mGFP tagged 10 ug
$600.00
RG204031 DRAP1 (tGFP-tagged) - Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116124 DRAP1 (untagged)-Human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.