CDCA4 (NM_145701) Human Tagged ORF Clone

SKU
RC203983
CDCA4 (Myc-DDK-tagged)-Human cell division cycle associated 4 (CDCA4), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDCA4
Synonyms HEPP; SEI-3/HEPP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203983 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGCACGAGGACTGAAGAGGAAATGTGTTGGCCACGAGGAAGACGTGGAGGGAGCCCTGGCCGGCT
TGAAGACAGTGTCCTCATACAGCCTGCAGCGGCAGTCGCTCCTGGACATGTCTCTGGTGAAGTTGCAGCT
TTGCCACATGCTTGTGGAGCCCAATCTGTGCCGCTCAGTCCTCATTGCCAACACGGTCCGGCAGATCCAA
GAGGAGATGACGCAGGATGGGACGTGGCGCACAGTGGCACCCCAGGCTGCAGAGCGGGCGCCGCTCGACC
GCTTGGTCTCCACGGAGATCCTGTGCCGTGCAGCGTGGGGGCAAGAGGGGGCACATCCTGCTCCTGGCTT
GGGGGACGGCCACACACAGGGTCCAGTTTCTGACCTTTGCCCAGTCACCTCAGCACAGGCACCAAGGCAC
CTGCAGAGCAGCGCCTGGGAGATGGATGGCCCTCGAGAAAACAGAGGAAGCTTTCACAAGTCACTTGATC
AGATATTTGAAACGCTGGAGACTAAAAACCCCAGCTGCATGGAAGAGCTGTTCTCAGACGTGGACAGCCC
CTACTACGACCTGGACACAGTACTGACAGGCATGATGGGGGGTGCCAGGCCGGGCCCCTGCGAAGGGCTC
GAGGGCTTGGCTCCGGCCACCCCAGGCCCTAGCTCCAGCTGCAAGTCCGACCTGGGCGAGCTGGACCACG
TGGTGGAGATCCTGGTGGAGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203983 protein sequence
Red=Cloning site Green=Tags(s)

MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQ
EEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRH
LQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGL
EGLAPATPGPSSSCKSDLGELDHVVEILVET

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145701
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145701.1, NP_663747.1
RefSeq Size 1927 bp
RefSeq ORF 726 bp
Locus ID 55038
UniProt ID Q9BXL8
Cytogenetics 14q32.33
Protein Families ES Cell Differentiation/IPS
MW 26.1 kDa
Summary This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulation of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:CDCA4 (NM_145701) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203983L3 Lenti ORF clone of Human cell division cycle associated 4 (CDCA4), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC203983L4 Lenti ORF clone of Human cell division cycle associated 4 (CDCA4), transcript variant 2, mGFP tagged 10 ug
$600.00
RG203983 CDCA4 (tGFP-tagged) - Human cell division cycle associated 4 (CDCA4), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124636 CDCA4 (untagged)-Human cell division cycle associated 4 (CDCA4), transcript variant 2 10 ug
$300.00
SC321153 CDCA4 (untagged)-Human cell division cycle associated 4 (CDCA4), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.