C1QC (NM_172369) Human Tagged ORF Clone

SKU
RC203832
C1QC (Myc-DDK-tagged)-Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C1QC
Synonyms C1Q-C; C1QG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203832 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGGGGCCCAGCTCCCTGCCCCACCTTGGGCTGAAGCTGCTGCTGCTCCTGCTGCTGCTGCCCC
TCAGGGGCCAAGCCAACACAGGCTGCTACGGGATCCCAGGGATGCCCGGCCTGCCTGGGGCACCAGGGAA
GGATGGGTACGACGGACTGCCGGGGCCCAAGGGGGAGCCAGGAATCCCAGCCATTCCCGGGATCCGAGGA
CCCAAAGGGCAGAAGGGAGAACCCGGCTTACCCGGCCATCCTGGGAAAAATGGCCCCATGGGACCCCCTG
GGATGCCAGGGGTGCCCGGCCCCATGGGCATCCCTGGAGAGCCAGGTGAGGAGGGCAGATACAAGCAGAA
ATTCCAGTCAGTGTTCACGGTCACTCGGCAGACCCACCAGCCCCCTGCACCCAACAGCCTGATCAGATTC
AACGCGGTCCTCACCAACCCGCAGGGAGATTATGACACGAGCACTGGCAAGTTCACCTGCAAAGTCCCCG
GCCTCTACTACTTTGTCTACCACGCGTCGCATACAGCCAACCTGTGCGTGCTGCTGTACCGCAGCGGCGT
CAAAGTGGTCACCTTCTGTGGCCACACGTCCAAAACCAATCAGGTCAACTCGGGCGGTGTGCTGCTGAGG
TTGCAGGTGGGCGAGGAGGTGTGGCTGGCTGTCAATGACTACTACGACATGGTGGGCATCCAGGGCTCTG
ACAGCGTCTTCTCCGGCTTCCTGCTCTTCCCCGAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203832 protein sequence
Red=Cloning site Green=Tags(s)

MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRG
PKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRF
NAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLR
LQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_172369
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172369.5
RefSeq Size 1182 bp
RefSeq ORF 738 bp
Locus ID 714
UniProt ID P02747
Cytogenetics 1p36.12
Protein Families Secreted Protein
Protein Pathways Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus
MW 25.8 kDa
Summary This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. [provided by RefSeq, Dec 2016]
Write Your Own Review
You're reviewing:C1QC (NM_172369) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203832L3 Lenti ORF clone of Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC203832L4 Lenti ORF clone of Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2, mGFP tagged 10 ug
$600.00
RG203832 C1QC (tGFP-tagged) - Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124311 C1QC (untagged)-Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2 10 ug
$300.00
SC322245 C1QC (untagged)-Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.