FAM107A (NM_001076778) Human Tagged ORF Clone

SKU
RC203787
FAM107A (Myc-DDK-tagged)-Human family with sequence similarity 107, member A (FAM107A), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAM107A
Synonyms DRR1; TU3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203787 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACTCGGAGATCCAGAGGGAGCGGGCAGACATTGGGGGCCTGATGGCCCGGCCAGAATACAGAGAGT
GGAATCCGGAGCTCATCAAGCCCAAGAAGCTGCTGAACCCCGTGAAGGCCTCTCGGAGTCACCAGGAGCT
CCACCGGGAGCTGCTCATGAACCACAGAAGGGGCCTTGGTGTGGACAGCAAGCCAGAGCTGCAGCGTGTC
CTAGAGCACCGCCGGCGGAACCAGCTCATCAAGAAGAAGAAGGAGGAGCTGGAAGCCAAGCGGCTGCAGT
GCCCCTTTGAGCAGGAGCTGCTGAGACGGCAGCAGAGGCTGAACCAGCTGGAAAAACCACCAGAGAAGGA
AGAGGATCACGCCCCCGAGTTTATTAAAGTCAGGGAAAACCTGCGGAGAATTGCCACACTGACCAGCGAA
GAGAGAGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203787 protein sequence
Red=Cloning site Green=Tags(s)

MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRV
LEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
EREL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001076778
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001076778.3
RefSeq Size 3390 bp
RefSeq ORF 435 bp
Locus ID 11170
UniProt ID O95990
Cytogenetics 3p14.3-p14.2
MW 17.5 kDa
Summary Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory (By similarity). Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner (PubMed:20543869). Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner (PubMed:10564580, PubMed:28604741). May play a role in tumor development (PubMed:10564580).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FAM107A (NM_001076778) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203787L3 Lenti ORF clone of Human family with sequence similarity 107, member A (FAM107A), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC203787L4 Lenti ORF clone of Human family with sequence similarity 107, member A (FAM107A), transcript variant 2, mGFP tagged 10 ug
$450.00
RG203787 FAM107A (tGFP-tagged) - Human family with sequence similarity 107, member A (FAM107A), transcript variant 2 10 ug
$350.00
SC322291 FAM107A (untagged)-Human family with sequence similarity 107, member A (FAM107A), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.