TNNI1 (NM_003281) Human Tagged ORF Clone
SKU
RC203127
TNNI1 (Myc-DDK-tagged)-Human troponin I type 1 (skeletal, slow) (TNNI1)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | TNNI1 |
Synonyms | SSTNI; TNN1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC203127 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGGAAGTCGAGAGAAAACCCAAGATCACTGCCTCCCGCAAACTCTTGCTGAAGAGCCTGATGCTGG CCAAGGCCAAGGAATGCTGGGAGCAGGAGCACGAGGAGCGCGAGGCTGAGAAGGTGCGCTACCTGGCAGA GCGCATCCCCACGCTGCAGACCCGTGGCCTGTCCCTCAGTGCCCTGCAGGACCTGTGCCGGGAGCTGCAC GCCAAGGTGGAGGTGGTGGATGAGGAGCGATACGACATTGAGGCCAAATGCCTCCACAACACCAGGGAGA TTAAGGACCTGAAGCTGAAGGTGATGGACCTCCGTGGGAAGTTCAAGCGCCCGCCCCTGCGTCGAGTCCG TGTCTCGGCTGACGCCATGCTCCGGGCCCTGCTGGGCTCCAAGCACAAGGTGTCCATGGATCTGCGGGCC AACCTCAAGTCTGTGAAGAAGGAAGACACAGAGAAGGAGCGGCCTGTGGAGGTGGGTGACTGGAGGAAGA ACGTGGAGGCCATGTCTGGCATGGAAGGCCGGAAGAAGATGTTTGATGCCGCCAAGTCTCCGACCTCACA A ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203127 protein sequence
Red=Cloning site Green=Tags(s) MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELH AKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRA NLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_003281 |
ORF Size | 561 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_003281.4 |
RefSeq Size | 6162 bp |
RefSeq ORF | 564 bp |
Locus ID | 7135 |
UniProt ID | P19237 |
Cytogenetics | 1q32.1 |
Domains | Troponin |
MW | 21.7 kDa |
Summary | Troponin proteins associate with tropomyosin and regulate the calcium sensitivity of the myofibril contractile apparatus of striated muscles. Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TnI-fast and TnI-slow genes are expressed in fast-twitch and slow-twitch skeletal muscle fibers, respectively, while the TnI-cardiac gene is expressed exclusively in cardiac muscle tissue. This gene encodes the Troponin-I-skeletal-slow-twitch protein. This gene is expressed in cardiac and skeletal muscle during early development but is restricted to slow-twitch skeletal muscle fibers in adults. The encoded protein prevents muscle contraction by inhibiting calcium-mediated conformational changes in actin-myosin complexes. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC203127L1 | Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC203127L2 | Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), mGFP tagged | 10 ug |
$600.00
|
|
RC203127L3 | Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC203127L4 | Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), mGFP tagged | 10 ug |
$600.00
|
|
RG203127 | TNNI1 (tGFP-tagged) - Human troponin I type 1 (skeletal, slow) (TNNI1) | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC118103 | TNNI1 (untagged)-Human troponin I type 1 (skeletal, slow) (TNNI1) | 10 ug |
$300.00
|
|
SC324445 | TNNI1 (untagged)-Human troponin I type 1 (skeletal, slow) (TNNI1) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.