TNNI1 (NM_003281) Human Tagged ORF Clone

SKU
RG203127
TNNI1 (tGFP-tagged) - Human troponin I type 1 (skeletal, slow) (TNNI1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TNNI1
Synonyms SSTNI; TNN1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203127 representing NM_003281
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGAAGTCGAGAGAAAACCCAAGATCACTGCCTCCCGCAAACTCTTGCTGAAGAGCCTGATGCTGG
CCAAGGCCAAGGAATGCTGGGAGCAGGAGCACGAGGAGCGCGAGGCTGAGAAGGTGCGCTACCTGGCAGA
GCGCATCCCCACGCTGCAGACCCGTGGCCTGTCCCTCAGTGCCCTGCAGGACCTGTGCCGGGAGCTGCAC
GCCAAGGTGGAGGTGGTGGATGAGGAGCGATACGACATTGAGGCCAAATGCCTCCACAACACCAGGGAGA
TTAAGGACCTGAAGCTGAAGGTGATGGACCTCCGTGGGAAGTTCAAGCGCCCGCCCCTGCGTCGAGTCCG
TGTCTCGGCTGACGCCATGCTCCGGGCCCTGCTGGGCTCCAAGCACAAGGTGTCCATGGATCTGCGGGCC
AACCTCAAGTCTGTGAAGAAGGAAGACACAGAGAAGGAGCGGCCTGTGGAGGTGGGTGACTGGAGGAAGA
ACGTGGAGGCCATGTCTGGCATGGAAGGCCGGAAGAAGATGTTTGATGCCGCCAAGTCTCCGACCTCACA
A


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203127 representing NM_003281
Red=Cloning site Green=Tags(s)

MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELH
AKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRA
NLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003281
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003281.4
RefSeq Size 6162 bp
RefSeq ORF 564 bp
Locus ID 7135
UniProt ID P19237
Cytogenetics 1q32.1
Domains Troponin
Summary Troponin proteins associate with tropomyosin and regulate the calcium sensitivity of the myofibril contractile apparatus of striated muscles. Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TnI-fast and TnI-slow genes are expressed in fast-twitch and slow-twitch skeletal muscle fibers, respectively, while the TnI-cardiac gene is expressed exclusively in cardiac muscle tissue. This gene encodes the Troponin-I-skeletal-slow-twitch protein. This gene is expressed in cardiac and skeletal muscle during early development but is restricted to slow-twitch skeletal muscle fibers in adults. The encoded protein prevents muscle contraction by inhibiting calcium-mediated conformational changes in actin-myosin complexes. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TNNI1 (NM_003281) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203127 TNNI1 (Myc-DDK-tagged)-Human troponin I type 1 (skeletal, slow) (TNNI1) 10 ug
$300.00
RC203127L1 Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), Myc-DDK-tagged 10 ug
$600.00
RC203127L2 Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), mGFP tagged 10 ug
$600.00
RC203127L3 Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), Myc-DDK-tagged 10 ug
$600.00
RC203127L4 Lenti ORF clone of Human troponin I type 1 (skeletal, slow) (TNNI1), mGFP tagged 10 ug
$600.00
SC118103 TNNI1 (untagged)-Human troponin I type 1 (skeletal, slow) (TNNI1) 10 ug
$300.00
SC324445 TNNI1 (untagged)-Human troponin I type 1 (skeletal, slow) (TNNI1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.