BCCIP (NM_078468) Human Tagged ORF Clone

SKU
RC203061
BCCIP (Myc-DDK-tagged)-Human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BCCIP
Synonyms TOK-1; TOK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203061 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCAGGTCTAAGCGGCGTGCCGTGGAAAGTGGGGTTCCGCAGCCGCCGGATCCCCCAGTCCAGC
GCGACGAGGAAGAGGAAAAAGAAGTCGAAAATGAGGATGAAGACGATGATGACAGTGACAAGGAAAAGGA
TGAAGAGGACGAGGTCATTGACGAGGAAGTGAATATTGAATTTGAAGCTTATTCCCTATCAGATAATGAT
TATGACGGAATTAAGAAATTACTGCAGCAGCTTTTTCTAAAGGCTCCTGTGAACACTGCAGAACTAACAG
ATCTCTTAATTCAACAGAACCATATTGGGAGTGTGATTAAGCAAACGGATGTTTCAGAAGACAGCAATGA
TGATATGGATGAAGATGAGGTTTTTGGTTTCATAAGCCTTTTAAATTTAACTGAAAGAAAGGGTACCCAG
TGTGTTGAACAAATTCAAGAGTTGGTTCTACGCTTCTGTGAGAAGAACTGTGAAAAGAGCATGGTTGAAC
AGCTGGACAAGTTTTTAAATGACACCACCAAGCCTGTGGGCCTTCTCCTAAGTGAAAGATTCATTAATGT
CCCTCCACAGATCGCTCTGCCCATGTACCAGCAGCTTCAGAAAGAACTGGCGGGGGCACACAGAACCAAT
AAGCCATGTGGGAAGTGCTACTTTTACCTTCTGATTAGTAAGACATTTGTGGAAGCAGAAAAAAACAATT
CCAAAAAGAAACCTAGCAACAAAAAGAAAGCTGCGTTAATGTTTGCAAATGCAGAGGAAGAATTTTTCTA
TGAGAAGGCAATTCTCAAGTTCAACTACTCAGTGCAGGAGGAGAGCGACACTTGTCTGGGAGGCAAATGG
TCTTTTGATGACGTACCAATGACGCCCTTGCGAACTGTGATGTTAATTCCAGGCGACAAGATGAACGAAA
TCATGGATAAACTGAAAGAATATCTATCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203061 protein sequence
Red=Cloning site Green=Tags(s)

MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN
KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_078468
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_078468.3
RefSeq Size 1261 bp
RefSeq ORF 945 bp
Locus ID 56647
UniProt ID Q9P287
Cytogenetics 10q26.2
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 36.1 kDa
Summary This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:BCCIP (NM_078468) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203061L3 Lenti ORF clone of Human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B, Myc-DDK-tagged 10 ug
$600.00
RC203061L4 Lenti ORF clone of Human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B, mGFP tagged 10 ug
$600.00
RG203061 BCCIP (tGFP-tagged) - Human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319236 BCCIP (untagged)-Human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.