MED31 (NM_016060) Human Tagged ORF Clone

SKU
RC203047
MED31 (Myc-DDK-tagged)-Human mediator complex subunit 31 (MED31)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MED31
Synonyms 3110004H13Rik; CGI-125; Soh1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203047 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCTGCTGTCGCTATGGAGACAGATGATGCTGGAAATCGACTTCGGTTTCAGTTGGAGTTGGAAT
TTGTGCAATGTTTAGCCAACCCAAATTACCTTAATTTTCTTGCCCAAAGAGGTTACTTCAAAGACAAAGC
TTTTGTTAATTATCTTAAATACTTGCTTTACTGGAAAGACCCAGAATATGCCAAGTATCTAAAGTACCCT
CAGTGTTTACACATGTTAGAGCTGCTCCAATATGAACACTTCCGAAAGGAGCTGGTGAATGCTCAGTGTG
CGAAATTTATTGATGAACAGCAGATTCTACATTGGCAGCACTATTCCCGGAAGCGGATGCGCCTTCAGCA
AGCCTTGGCAGAGCAGCAACAGCAAAATAACACATCGGGAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203047 protein sequence
Red=Cloning site Green=Tags(s)

MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP
QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016060
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016060.3
RefSeq Size 1656 bp
RefSeq ORF 396 bp
Locus ID 51003
UniProt ID Q9Y3C7
Cytogenetics 17p13.1
Protein Families Transcription Factors
MW 15.8 kDa
Summary Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MED31 (NM_016060) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203047L3 Lenti ORF clone of Human mediator complex subunit 31 (MED31), Myc-DDK-tagged 10 ug
$450.00
RC203047L4 Lenti ORF clone of Human mediator complex subunit 31 (MED31), mGFP tagged 10 ug
$450.00
RG203047 MED31 (tGFP-tagged) - Human mediator complex subunit 31 (MED31) 10 ug
$489.00
SC114523 MED31 (untagged)-Human mediator complex subunit 31 (MED31) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.