CLN8 (NM_018941) Human Tagged ORF Clone

SKU
RC202936
CLN8 (Myc-DDK-tagged)-Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLN8
Synonyms C8orf61; EPMR; TLCD6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202936 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCTGCGAGCGATGGGGGCACATCAGAGAGCATTTTTGACCTGGACTATGCATCCTGGGGGATCC
GCTCCACGCTGATGGTCGCTGGCTTTGTCTTCTACTTGGGCGTCTTTGTGGTCTGCCACCAGCTGTCCTC
TTCCCTGAATGCCACTTACCGTTCTTTGGTGGCCAGAGAGAAGGTCTTCTGGGACCTGGCGGCCACGCGT
GCAGTCTTTGGTGTTCAGAGCACAGCCGCAGGCCTGTGGGCTCTGCTGGGGGACCCTGTGCTGCATGCCG
ACAAGGCGCGTGGCCAGCAGAACTGGTGCTGGTTTCACATCACGACAGCAACGGGATTCTTTTGCTTTGA
AAATGTTGCAGTCCACCTGTCCAACTTGATCTTCCGGACATTTGACTTGTTTCTGGTTATCCACCATCTC
TTTGCCTTTCTTGGGTTTCTTGGCTGCTTGGTCAATCTCCAAGCTGGCCACTATCTAGCTATGACCACGT
TGCTCCTGGAGATGAGCACGCCCTTTACCTGCGTTTCCTGGATGCTCTTAAAGGCGGGCTGGTCCGAGTC
TCTGTTTTGGAAGCTCAACCAGTGGCTGATGATTCACATGTTTCACTGCCGCATGGTTCTAACCTACCAC
ATGTGGTGGGTGTGTTTCTGGCACTGGGACGGCCTGGTCAGCAGCCTGTATCTGCCTCATTTGACACTGT
TCCTTGTCGGACTGGCTCTGCTTACGCTAATCATTAATCCATATTGGACCCATAAGAAGACTCAGCAGCT
TCTCAATCCGGTGGACTGGAACTTCGCACAGCCAGAAGCCAAGAGCAGGCCAGAAGGCAACGGGCAGCTG
CTGCGGAAGAAGAGGCCA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202936 protein sequence
Red=Cloning site Green=Tags(s)

MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLNATYRSLVAREKVFWDLAATR
AVFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAVHLSNLIFRTFDLFLVIHHL
FAFLGFLGCLVNLQAGHYLAMTTLLLEMSTPFTCVSWMLLKAGWSESLFWKLNQWLMIHMFHCRMVLTYH
MWWVCFWHWDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQL
LRKKRP

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_018941
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018941.4
RefSeq Size 7185 bp
RefSeq ORF 861 bp
Locus ID 2055
UniProt ID Q9UBY8
Cytogenetics 8p23.3
Domains TLC
Protein Families Druggable Genome, Transmembrane
MW 32.8 kDa
Summary This gene encodes a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment. Mutations in this gene are associated with a disorder characterized by progressive epilepsy with cognitive disabilities (EPMR), which is a subtype of neuronal ceroid lipofuscinoses (NCL). Patients with mutations in this gene have altered levels of sphingolipid and phospholipids in the brain. [provided by RefSeq, Jul 2017]
Write Your Own Review
You're reviewing:CLN8 (NM_018941) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202936L3 Lenti ORF clone of Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8), Myc-DDK-tagged 10 ug
$600.00
RC202936L4 Lenti ORF clone of Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8), mGFP tagged 10 ug
$600.00
RG202936 CLN8 (tGFP-tagged) - Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113338 CLN8 (untagged)-Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8) 10 ug
$300.00
SC320766 CLN8 (untagged)-Human ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) (CLN8) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.