ICAD (DFFA) (NM_004401) Human Tagged ORF Clone

SKU
RC202879
DFFA (Myc-DDK-tagged)-Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ICAD
Synonyms DFF-45; DFF1; ICAD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202879 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGACCGGGGACGCCGGGGTACCAGAATCTGGCGAGATCCGGACTCTAAAGCCGTGTCTGCTGC
GCCGCAACTACAGCCGCGAACAGCACGGCGTGGCCGCCTCCTGCCTCGAAGACCTGAGGAGCAAGGCCTG
TGACATTCTGGCCATTGATAAGTCCCTGACACCAGTCACCCTGGTCCTGGCAGAGGATGGCACCATAGTG
GATGATGACGATTACTTTCTGTGTCTACCTTCCAATACTAAGTTTGTGGCATTGGCTAGTAATGAGAAAT
GGGCATACAACAATTCAGATGGAGGTACAGCTTGGATTTCCCAAGAGTCCTTTGATGTAGATGAAACAGA
CAGCGGGGCAGGGTTGAAGTGGAAGAATGTGGCCAGGCAGCTGAAAGAAGATCTGTCCAGCATCATCCTC
CTATCAGAGGAGGACCTCCAGATGCTTGTTGACGCTCCCTGCTCAGACCTGGCTCAGGAACTACGTCAGA
GTTGTGCCACCGTCCAGCGGCTGCAGCACACACTCCAACAGGTGCTTGACCAAAGAGAGGAAGTGCGTCA
GTCCAAGCAGCTCCTGCAGCTGTACCTCCAGGCTTTGGAGAAAGAGGGCAGCCTCTTGTCAAAGCAGGAA
GAGTCCAAAGCTGCCTTTGGTGAGGAGGTGGATGCAGTAGACACGGGTATCAGCAGAGAGACCTCCTCGG
ACGTTGCGCTGGCGAGCCACATCCTTACTGCACTGAGGGAGAAGCAGGCTCCAGAGCTGAGCTTATCTAG
TCAGGATTTGGAGTTGGTTACCAAGGAAGACCCCAAAGCACTGGCTGTTGCCTTGAACTGGGACATAAAG
AAGACGGAGACTGTTCAGGAGGCCTGTGAGTGGGAGCTCGCCCTGCGCCTGCAGCAGACGCAGAGCTTGC
ATTCTCTCCGGAGCATCTCAGCAAGCAAGGCCTCACCACCTGGTGACCTGCAGAATCCTAAGCGAGCCAG
ACAGGATCCCACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202879 protein sequence
Red=Cloning site Green=Tags(s)

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV
DDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIIL
LSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQE
ESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK
KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004401
ORF Size 993 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004401.3
RefSeq Size 2053 bp
RefSeq ORF 996 bp
Locus ID 1676
UniProt ID O00273
Cytogenetics 1p36.22
Domains CAD
Protein Pathways Apoptosis
MW 36.6 kDa
Summary Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ICAD (DFFA) (NM_004401) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202879L3 Lenti ORF clone of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202879L4 Lenti ORF clone of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202879 DFFA (tGFP-tagged) - Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319133 DFFA (untagged)-Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.