PHAP1 (ANP32A) (NM_006305) Human Tagged ORF Clone

SKU
RC202868
ANP32A (Myc-DDK-tagged)-Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PHAP1
Synonyms C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202868 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGATGGGCAGACGGATTCATTTAGAGCTGCGGAACAGGACGCCCTCTGATGTGAAAGAACTTGTCC
TGGACAACAGTCGGTCGAATGAAGGCAAACTCGAAGGCCTCACAGATGAATTTGAAGAACTGGAATTCTT
AAGTACAATCAACGTAGGCCTCACCTCAATCGCAAACTTACCAAAGTTAAACAAACTTAAGAAGCTTGAA
CTAAGCGATAACAGAGTCTCAGGGGGCCTGGAAGTATTGGCAGAAAAGTGTCCGAACCTCACGCATCTAA
ATTTAAGTGGCAACAAAATTAAAGACCTCAGCACAATAGAGCCACTGAAAAAGTTAGAAAACCTCAAGAG
CTTAGACCTTTTCAATTGCGAGGTAACCAACCTGAACGACTACCGAGAAAATGTGTTCAAGCTCCTCCCG
CAACTCACATATCTCGACGGCTATGACCGGGACGACAAGGAGGCCCCTGACTCGGATGCTGAGGGCTACG
TGGAGGGCCTGGATGATGAGGAGGAGGATGAGGATGAGGAGGAGTATGATGAAGATGCTCAGGTAGTGGA
AGACGAGGAGGACGAGGATGAGGAGGAGGAAGGTGAAGAGGAGGACGTGAGTGGAGAGGAGGAGGAGGAT
GAAGAAGGTTATAACGATGGAGAGGTAGATGACGAGGAAGATGAAGAAGAGCTTGGTGAAGAAGAAAGGG
GTCAGAAGCGAAAACGAGAACCTGAAGATGAGGGAGAAGATGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202868 protein sequence
Red=Cloning site Green=Tags(s)

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006305
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006305.4
RefSeq Size 2479 bp
RefSeq ORF 750 bp
Locus ID 8125
UniProt ID P39687
Cytogenetics 15q23
Domains LRR, LRRcap
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 28.6 kDa
Summary Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PHAP1 (ANP32A) (NM_006305) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202868L1 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), Myc-DDK-tagged 10 ug
$600.00
RC202868L2 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), mGFP tagged 10 ug
$600.00
RC202868L3 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), Myc-DDK-tagged 10 ug
$600.00
RC202868L4 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), mGFP tagged 10 ug
$600.00
RG202868 ANP32A (tGFP-tagged) - Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116212 ANP32A (untagged)-Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.