ZNF346 (NM_012279) Human Tagged ORF Clone

SKU
RC202856
ZNF346 (Myc-DDK-tagged)-Human zinc finger protein 346 (ZNF346)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZNF346
Synonyms JAZ; Zfp346
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202856 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTATCCCGCGCCGGCCACGGTGCAGGCCGCGGACGGCGGAGCGGCCGGGCCTTACAGCAGCTCGG
AGTTGCTGGAGGGCCAGGAGCCGGACGGGGTGCGCTTTGACCGCGAGAGGGCGCGCCGCCTGTGGGAAGC
CGTGTCCGGTGCCCAGCCGGTGGGTAGAGAGGAAGTGGAGCACATGATCCAGAAGAACCAATGTCTCTTC
ACCAACACCCAGTGTAAGGTTTGCTGCGCCTTGCTTATTTCTGAGTCCCAGAAGCTGGCACATTACCAGA
GCAAAAAACATGCCAACAAAGTGAAGAGATACCTAGCAATCCATGGAATGGAGACATTAAAGGGGGAAAC
GAAGAAGCTAGACTCAGATCAGAAGAGCAGCAGAAGCAAAGACAAGAACCAGTGCTGCCCCATCTGTAAC
ATGACCTTTTCCTCCCCTGTCGTGGCCCAGTCGCACTACCTGGGGAAGACCCACGCAAAGAACTTAAAGC
TGAAGCAGCAGTCCACTAAGGTGGAAGCCTTGCACCAGAATAGAGAGATGATAGACCCAGACAAGTTCTG
CAGCCTCTGCCATGCAACTTTCAACGACCCTGTCATGGCTCAACAACATTATGTGGGCAAGAAACACAGA
AAACAGGAGACCAAGCTCAAACTAATGGCACGCTATGGGCGGCTGGCGGACCCTGCTGTCACTGACTTTC
CAGCTGGAAAGGGCTACCCCTGCAAAACATGTAAGATAGTGCTGAACTCCATAGAACAGTACCAAGCTCA
TGTCAGCGGCTTCAAACACAAGAACCAGTCACCAAAAACAGTGGCATCATCCCTGGGCCAGATTCCAATG
CAAAGGCAACCCATTCAGAAAGACTCAACCACCTTGGAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202856 protein sequence
Red=Cloning site Green=Tags(s)

MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF
TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN
MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR
KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM
QRQPIQKDSTTLED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012279
ORF Size 882 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012279.4
RefSeq Size 3089 bp
RefSeq ORF 885 bp
Locus ID 23567
UniProt ID Q9UL40
Cytogenetics 5q35.2
Domains zf-C2H2, ZnF_U1
Protein Families Druggable Genome
MW 32.9 kDa
Summary The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. It plays a role in protecting neurons by inhibiting cell cycle re-entry via stimulation of p21 gene expression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2015]
Write Your Own Review
You're reviewing:ZNF346 (NM_012279) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202856L1 Lenti ORF clone of Human zinc finger protein 346 (ZNF346), Myc-DDK-tagged 10 ug
$600.00
RC202856L2 Lenti ORF clone of Human zinc finger protein 346 (ZNF346), mGFP tagged 10 ug
$600.00
RC202856L3 Lenti ORF clone of Human zinc finger protein 346 (ZNF346), Myc-DDK-tagged 10 ug
$600.00
RC202856L4 Lenti ORF clone of Human zinc finger protein 346 (ZNF346), mGFP tagged 10 ug
$600.00
RG202856 ZNF346 (tGFP-tagged) - Human zinc finger protein 346 (ZNF346) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320167 ZNF346 (untagged)-Human zinc finger protein 346 (ZNF346) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.