DPM1 (NM_003859) Human Tagged ORF Clone

SKU
RC202817
DPM1 (Myc-DDK-tagged)-Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPM1
Synonyms CDGIE; MPDS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202817 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCTTGGAAGTCAGTCGTAGTCCTCGCAGGTCTCGGCGGGAGCTGGAAGTGCGCAGTCCACGAC
AGAACAAATATTCGGTGCTTTTACCTACCTACAACGAGCGCGAGAACCTGCCGCTCATCGTGTGGCTGCT
GGTGAAAAGCTTCTCCGAGAGTGGAATCAACTATGAAATTATAATCATAGATGATGGAAGCCCAGATGGA
ACAAGGGATGTTGCTGAACAGTTGGAGAAGATCTATGGGTCAGACAGAATTCTTCTAAGACCACGAGAGA
AAAAGTTGGGACTAGGAACTGCATATATTCATGGAATGAAACATGCCACAGGAAACTACATCATTATTAT
GGATGCTGATCTCTCACACCATCCAAAATTTATTCCTGAATTTATTAGGAAGCAAAAGGAGGGTAATTTT
GATATTGTCTCTGGAACTCGCTACAAAGGAAATGGAGGTGTATATGGCTGGGATTTGAAAAGAAAAATAA
TCAGCCGTGGGGCCAATTTTTTAACTCAGATCTTGCTGAGACCAGGAGCATCTGATTTAACAGGAAGTTT
CAGATTATACCGAAAAGAAGTTCTAGAGAAATTAATAGAAAAATGTGTTTCTAAAGGCTACGTCTTCCAG
ATGGAGATGATTGTTCGGGCAAGACAGTTGAATTATACTATTGGCGAGGTTCCAATATCATTTGTGGATC
GTGTTTATGGTGAATCCAAGTTGGGAGGAAATGAAATAGTATCTTTCTTGAAAGGATTATTGACTCTTTT
TGCTACTACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202817 protein sequence
Red=Cloning site Green=Tags(s)

MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDG
TRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNF
DIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQ
MEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003859
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003859.3
RefSeq Size 1047 bp
RefSeq ORF 783 bp
Locus ID 8813
UniProt ID O60762
Cytogenetics 20q13.13
Domains Glycos_transf_2
Protein Pathways Metabolic pathways, N-Glycan biosynthesis
MW 29.6 kDa
Summary Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:DPM1 (NM_003859) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202817L1 Lenti ORF clone of Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1), Myc-DDK-tagged 10 ug
$600.00
RC202817L2 Lenti ORF clone of Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1), mGFP tagged 10 ug
$600.00
RC202817L3 Lenti ORF clone of Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1), Myc-DDK-tagged 10 ug
$600.00
RC202817L4 Lenti ORF clone of Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1), mGFP tagged 10 ug
$600.00
RG202817 DPM1 (tGFP-tagged) - Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC128254 DPM1 (untagged)-Human dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (DPM1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.