PSP (REG1A) (NM_002909) Human Tagged ORF Clone
SKU
RC202773
REG1A (Myc-DDK-tagged)-Human regenerating islet-derived 1 alpha (REG1A)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | REG1 alpha |
Synonyms | ICRF; P19; PSP; PSPS; PSPS1; PTP; REG |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC202773 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCAGACCAGCTCATACTTCATGCTGATCTCCTGCCTGATGTTTCTGTCTCAGAGCCAAGGCCAAG AGGCCCAGACAGAGTTGCCCCAGGCCCGGATCAGCTGCCCAGAAGGCACCAATGCCTATCGCTCCTACTG CTACTACTTTAATGAAGACCGTGAGACCTGGGTTGATGCAGATCTCTATTGCCAGAACATGAATTCGGGC AACCTGGTGTCTGTGCTCACCCAGGCCGAGGGTGCCTTTGTGGCCTCACTGATTAAGGAGAGTGGCACTG ATGACTTCAATGTCTGGATTGGCCTCCATGACCCCAAAAAGAACCGCCGCTGGCACTGGAGCAGTGGGTC CCTGGTCTCCTACAAGTCCTGGGGCATTGGAGCCCCAAGCAGTGTTAATCCTGGCTACTGTGTGAGCCTG ACCTCAAGCACAGGATTCCAGAAATGGAAGGATGTGCCTTGTGAAGACAAGTTCTCCTTTGTCTGCAAGT TCAAAAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202773 protein sequence
Red=Cloning site Green=Tags(s) MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSG NLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSL TSSTGFQKWKDVPCEDKFSFVCKFKN myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002909 |
ORF Size | 498 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_002909.5 |
RefSeq Size | 821 bp |
RefSeq ORF | 501 bp |
Locus ID | 5967 |
UniProt ID | P05451 |
Cytogenetics | 2p12 |
MW | 18.7 kDa |
Summary | This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC202773L1 | Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC202773L2 | Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), mGFP tagged | 10 ug |
$450.00
|
|
RC202773L3 | Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC202773L4 | Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), mGFP tagged | 10 ug |
$450.00
|
|
RG202773 | REG1A (tGFP-tagged) - Human regenerating islet-derived 1 alpha (REG1A) | 10 ug |
$489.00
|
|
SC122637 | REG1A (untagged)-Human regenerating islet-derived 1 alpha (REG1A) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.