PSP (REG1A) (NM_002909) Human Tagged ORF Clone

SKU
RG202773
REG1A (tGFP-tagged) - Human regenerating islet-derived 1 alpha (REG1A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol REG1 alpha
Synonyms ICRF; P19; PSP; PSPS; PSPS1; PTP; REG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202773 representing NM_002909
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCAGACCAGCTCATACTTCATGCTGATCTCCTGCCTGATGTTTCTGTCTCAGAGCCAAGGCCAAG
AGGCCCAGACAGAGTTGCCCCAGGCCCGGATCAGCTGCCCAGAAGGCACCAATGCCTATCGCTCCTACTG
CTACTACTTTAATGAAGACCGTGAGACCTGGGTTGATGCAGATCTCTATTGCCAGAACATGAATTCGGGC
AACCTGGTGTCTGTGCTCACCCAGGCCGAGGGTGCCTTTGTGGCCTCACTGATTAAGGAGAGTGGCACTG
ATGACTTCAATGTCTGGATTGGCCTCCATGACCCCAAAAAGAACCGCCGCTGGCACTGGAGCAGTGGGTC
CCTGGTCTCCTACAAGTCCTGGGGCATTGGAGCCCCAAGCAGTGTTAATCCTGGCTACTGTGTGAGCCTG
ACCTCAAGCACAGGATTCCAGAAATGGAAGGATGTGCCTTGTGAAGACAAGTTCTCCTTTGTCTGCAAGT
TCAAAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202773 representing NM_002909
Red=Cloning site Green=Tags(s)

MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSG
NLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSL
TSSTGFQKWKDVPCEDKFSFVCKFKN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002909
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002909.5
RefSeq Size 808 bp
RefSeq ORF 501 bp
Locus ID 5967
UniProt ID P05451
Cytogenetics 2p12
Summary This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PSP (REG1A) (NM_002909) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202773 REG1A (Myc-DDK-tagged)-Human regenerating islet-derived 1 alpha (REG1A) 10 ug
$150.00
RC202773L1 Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), Myc-DDK-tagged 10 ug
$450.00
RC202773L2 Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), mGFP tagged 10 ug
$450.00
RC202773L3 Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), Myc-DDK-tagged 10 ug
$450.00
RC202773L4 Lenti ORF clone of Human regenerating islet-derived 1 alpha (REG1A), mGFP tagged 10 ug
$450.00
SC122637 REG1A (untagged)-Human regenerating islet-derived 1 alpha (REG1A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.