Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone

SKU
RC202667
KLK2 (Myc-DDK-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Kallikrein 2
Synonyms hGK-1; hK2; KLK2A2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202667 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGACCTGGTTCTCTCCATCGCCTTGTCTGTGGGGTGCACTGGTGCCGTGCCCCTCATCCAGTCTC
GGATTGTGGGAGGCTGGGAGTGTGAGAAGCATTCCCAACCCTGGCAGGTGGCTGTGTACAGTCATGGATG
GGCACACTGTGGGGGTGTCCTGGTGCACCCCCAGTGGGTGCTCACAGCTGCCCATTGCCTAAAGAAGAAT
AGCCAGGTCTGGCTGGGTCGGCACAACCTGTTTGAGCCTGAAGACACAGGCCAGAGGGTCCCTGTCAGCC
ACAGCTTCCCACACCCGCTCTACAATATGAGCCTTCTGAAGCATCAAAGCCTTAGACCAGATGAAGACTC
CAGCCATGACCTCATGCTGCTTCGCCTGTCAGAGCCTGCCAAGATCACAGATGTTGTGAAGGTCCTGGGC
CTGCCCACCCAGGAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGGCAGCATCGAACCAGAGG
AGTTCTTGCGCCCCAGGAGTCTTCAGTGTGTGAGCCTCCATCTCCTGTCCAATGACATGTGTGCTAGAGC
TTACTCTGAGAAGGTGACAGAGTTCATGTTGTGTGCTGGGCTCTGGACAGGTGGTAAAGACACTTGTGGG
GGTGATTCTGGGGGTCCACTTGTCTGTAATGGTGTGCTTCAAGGTATCACATCATGGGGCCCTGAGCCAT
GTGCCCTGCCTGAAAAGCCTGCTGTGTACACCAAGGTGGTGCATTACCGGAAGTGGATCAAGGACACCAT
CGCAGCCAACCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202667 protein sequence
Red=Cloning site Green=Tags(s)

MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN
SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG
LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG
GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005551
ORF Size 783 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005551.2
RefSeq Size 2855 bp
RefSeq ORF 786 bp
Locus ID 3817
UniProt ID P20151
Cytogenetics 19q13.33
Domains Tryp_SPc
Protein Families Druggable Genome, Protease
MW 28.7 kDa
Summary This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202667L1 Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC202667L2 Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, mGFP tagged 10 ug
$750.00
RC202667L3 Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC202667L4 Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, mGFP tagged 10 ug
$750.00
RG202667 KLK2 (tGFP-tagged) - Human kallikrein-related peptidase 2 (KLK2), transcript variant 1 10 ug
$650.00
SC110938 KLK2 (untagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.