MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Tagged ORF Clone

SKU
RC202640
MAD2L1BP (Myc-DDK-tagged)-Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAD2L1 binding protein
Synonyms CMT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202640 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCGGAGGCGGAGGTTCTGTCCTCAGCCGCAGTCCCTGATTTGGAGTGGTATGAGAAGTCCG
AAGAAACTCACGCCTCCCAGATAGAACTACTTGAGACAAGCTCTACGCAGGAACCTCTCAACGCTTCGGA
GGCCTTTTGCCCAAGAGACTGCATGGTACCAGTGGTGTTTCCTGGGCCTGTGAGCCAGGAAGGCTGCTGT
CAGTTTACTTGTGAACTTCTAAAGCATATCATGTATCAACGCCAGCAGCTCCCTCTGCCCTATGAACAGC
TTAAGCACTTTTACCGAAAACCTTCTCCCCAGGCAGAGGAGATGCTGAAGAAGAAACCTCGGGCCACCAC
TGAGGTGAGCAGCAGGAAATGCCAACAAGCCCTGGCAGAACTGGAGAGTGTCCTCAGCCACCTGGAGGAC
TTCTTTGCACGGACACTAGTACCGCGAGTGCTGATTCTCCTTGGGGGCAATGCCCTAAGCCCCAAGGAGT
TCTATGAACTCGACTTGTCTCTGCTGGCCCCCTACAGCGTGGACCAGAGCCTGAGCACAGCAGCTTGTTT
GCGCCGTCTCTTCCGAGCCATATTCATGGCTGATGCCTTTAGCGAGCTTCAGGCTCCTCCACTCATGGGC
ACCGTCGTCATGGCACAGGGACACCGCAACTGTGGAGAAGATTGGTTTCGACCCAAGCTCAACTATCGAG
TGCCCAGCCGGGGCCATAAACTGACTGTGACCCTGTCATGTGGCAGACCTTCCATCCGAACCACGGCTTG
GGAAGACTACATTTGGTTCCAGGCACCAGTGACATTTAAAGGCTTCCGCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202640 protein sequence
Red=Cloning site Green=Tags(s)

MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014628
ORF Size 822 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014628.3
RefSeq Size 1283 bp
RefSeq ORF 825 bp
Locus ID 9587
UniProt ID Q15013
Cytogenetics 6p21.1
Protein Families Druggable Genome
MW 31.1 kDa
Summary The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202640L1 Lenti ORF clone of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC202640L2 Lenti ORF clone of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, mGFP tagged 10 ug
$600.00
RC202640L3 Lenti ORF clone of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC202640L4 Lenti ORF clone of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, mGFP tagged 10 ug
$600.00
RG202640 MAD2L1BP (tGFP-tagged) - Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319109 MAD2L1BP (untagged)-Human MAD2L1 binding protein (MAD2L1BP), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.