Rab4 (RAB4A) (NM_004578) Human Tagged ORF Clone

SKU
RC202572
RAB4A (Myc-DDK-tagged)-Human RAB4A, member RAS oncogene family (RAB4A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Rab4
Synonyms HRES-1; HRES-1/RAB4; HRES1; RAB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202572 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCAGACGGCCATGTCCGAAACCTACGATTTTTTGTTTAAGTTCTTGGTTATTGGAAATGCAGGAA
CTGGCAAATCTTGCTTACTTCATCAGTTTATTGAAAAAAAATTCAAAGATGACTCAAATCATACAATAGG
AGTGGAATTTGGTTCAAAGATAATAAATGTTGGTGGTAAATATGTAAAGTTACAAATATGGGATACAGCA
GGACAAGAACGATTCAGGTCCGTGACGAGAAGTTATTACCGAGGCGCGGCCGGGGCTCTCCTCGTCTATG
ATATCACCAGCCGAGAAACCTACAATGCGCTTACTAATTGGTTAACAGATGCCCGAATGCTAGCGAGCCA
GAACATTGTGATCATCCTTTGTGGAAACAAGAAGGACCTGGATGCAGATCGTGAAGTTACCTTCTTAGAA
GCCTCCAGATTTGCTCAAGAAAATGAGCTGATGTTTTTGGAAACAAGTGCGCTCACAGGGGAGAATGTAG
AAGAGGCTTTTGTACAGTGTGCAAGAAAAATACTTAACAAAATCGAATCAGGTGAGCTGGACCCAGAAAG
AATGGGCTCAGGTATTCAGTACGGAGATGCTGCCTTGAGACAGCTGAGGTCACCGCGGCGCGCACAGGCC
CCGAACGCTCAGGAGTGTGGTTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202572 protein sequence
Red=Cloning site Green=Tags(s)

MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA
GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE
ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA
PNAQECGC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004578
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004578.4
RefSeq Size 3056 bp
RefSeq ORF 657 bp
Locus ID 5867
UniProt ID P20338
Cytogenetics 1q42.13
Domains ARF, RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 24.4 kDa
Summary This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:Rab4 (RAB4A) (NM_004578) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202572L1 Lenti ORF clone of Human RAB4A, member RAS oncogene family (RAB4A), Myc-DDK-tagged 10 ug
$600.00
RC202572L2 Lenti ORF clone of Human RAB4A, member RAS oncogene family (RAB4A), mGFP tagged 10 ug
$600.00
RC202572L3 Lenti ORF clone of Human RAB4A, member RAS oncogene family (RAB4A), Myc-DDK-tagged 10 ug
$600.00
RC202572L4 Lenti ORF clone of Human RAB4A, member RAS oncogene family (RAB4A), mGFP tagged 10 ug
$600.00
RG202572 RAB4A (tGFP-tagged) - Human RAB4A, member RAS oncogene family (RAB4A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117288 RAB4A (untagged)-Human RAB4A, member RAS oncogene family (RAB4A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.