Rab4 (RAB4A) Rabbit Polyclonal Antibody

SKU
TA342684
Rabbit Polyclonal Anti-RAB4A Antibody
$585.00
In Stock*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 24 kDa
Gene Name RAB4A, member RAS oncogene family
Database Link
Background The function of this protein remains unknown.
Synonyms HRES-1; HRES1; RAB4
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:Rab4 (RAB4A) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.