SLBP (NM_006527) Human Tagged ORF Clone

SKU
RC202361
SLBP (Myc-DDK-tagged)-Human stem-loop binding protein (SLBP)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLBP
Synonyms HBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202361 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGCCGCCCGCGAAGCCCGCCGAGGCATCAGAGCCGCTGCGACGGTGACGCCAGCCCGCCGTCCC
CCGCGCGATGGAGCCTGGGACGGAAGCGCAGAGCCGACGGCAGGCGCTGGAGGCCCGAAGACGCCGAGGA
GGCAGAGCACCGCGGCGCCGAGCGCAGACCCGAGAGCTTTACCACTCCTGAAGGCCCTAAACCCCGTTCC
AGATGCTCTGACTGGGCAAGTGCAGTTGAAGAAGATGAAATGAGGACCAGAGTTAACAAAGAAATGGCAA
GATATAAAAGGAAACTCCTCATCAATGACTTTGGAAGAGAGAGAAAATCATCATCAGGAAGTTCTGATTC
AAAGGAGTCTATGTCTACTGTGCCGGCTGACTTTGAGACAGATGAAAGTGTCCTAATGAGGAGACAGAAG
CAGATCAACTATGGGAAGAACACAATTGCCTACGATCGTTATATTAAAGAAGTCCCAAGACACCTTCGAC
AACCTGGCATTCATCCCAAGACCCCTAATAAATTTAAGAAGTATAGTCGACGTTCATGGGACCAGCAAAT
CAAACTCTGGAAGGTGGCTCTGCATTTTTGGGATCCTCCAGCGGAAGAAGGATGTGATTTGCAAGAAATA
CACCCTGTAGACCTTGAATCTGCAGAAAGCAGCTCCGAGCCCCAGACCAGCTCTCAGGATGACTTTGATG
TGTACTCTGGCACACCCACCAAGGTGAGACACATGGACAGTCAAGTGGAGGATGAGTTTGATTTGGAAGC
TTGTTTAACTGAACCCTTGAGAGACTTCTCAGCCATGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202361 protein sequence
Red=Cloning site Green=Tags(s)

MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRS
RCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQK
QINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEI
HPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006527
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006527.4
RefSeq Size 1743 bp
RefSeq ORF 813 bp
Locus ID 7884
UniProt ID Q14493
Cytogenetics 4p16.3
MW 31.3 kDa
Summary This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SLBP (NM_006527) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202361L1 Lenti ORF clone of Human stem-loop binding protein (SLBP), Myc-DDK-tagged 10 ug
$600.00
RC202361L2 Lenti ORF clone of Human stem-loop binding protein (SLBP), mGFP tagged 10 ug
$600.00
RC202361L3 Lenti ORF clone of Human stem-loop binding protein (SLBP), Myc-DDK-tagged 10 ug
$600.00
RC202361L4 Lenti ORF clone of Human stem-loop binding protein (SLBP), mGFP tagged 10 ug
$600.00
RG202361 SLBP (tGFP-tagged) - Human stem-loop binding protein (SLBP) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116017 SLBP (untagged)-Human stem-loop binding protein (SLBP) 10 ug
$300.00
SC324002 SLBP (untagged)-Human stem-loop binding protein (SLBP) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.