SNAP29 (NM_004782) Human Tagged ORF Clone

SKU
RC202179
SNAP29 (Myc-DDK-tagged)-Human synaptosomal-associated protein, 29kDa (SNAP29)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNAP29
Synonyms CEDNIK; SNAP-29
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202179 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCTTACCCTAAGAGCTACAATCCGTTCGACGACGACGGGGAGGACGAAGGCGCCCGGCCGGCCC
CTTGGAGGGACGCCCGAGACCTCCCCGACGGGCCCGACGCGCCCGCGGACAGGCAGCAGTACTTGCGGCA
GGAGGTCCTCCGCAGGGCTGAGGCCACGGCCGCCAGCACCAGCAGGTCCCTGGCCCTCATGTACGAGTCC
GAGAAGGTTGGGGTCGCCTCTTCCGAGGAGCTCGCCCGTCAGCGAGGAGTCCTGGAGCGCACAGAGAAGA
TGGTGGACAAGATGGACCAAGATTTGAAGATCAGCCAGAAACACATCAATAGCATTAAGAGCGTGTTTGG
GGGGCTGGTCAATTACTTCAAATCCAAACCAGTAGAGACCCCACCTGAACAGAATGGCACCCTCACCTCC
CAGCCCAACAACAGATTGAAAGAAGCTATAAGTACAAGTAAAGAACAGGAAGCAAAGTACCAGGCCAGCC
ACCCAAACCTTAGAAAGCTGGATGATACAGACCCTGTCCCCAGAGGGGCTGGTTCTGCCATGAGTACTGA
TGCTTACCCAAAGAACCCACACCTTCGAGCCTATCACCAGAAGATCGACAGCAACCTAGATGAGCTGTCC
ATGGGACTGGGTCGTCTGAAGGACATAGCCCTGGGGATGCAGACAGAAATTGAGGAGCAAGATGACATTC
TTGACCGGCTGACAACCAAAGTGGACAAGTTAGATGTCAACATAAAAAGCACAGAAAGAAAAGTTCGACA
ACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202179 protein sequence
Red=Cloning site Green=Tags(s)

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES
EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS
MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004782
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004782.4
RefSeq Size 4277 bp
RefSeq ORF 777 bp
Locus ID 9342
UniProt ID O95721
Cytogenetics 22q11.21
Domains SNAP-25, t_SNARE
Protein Families Druggable Genome
Protein Pathways SNARE interactions in vesicular transport
MW 29 kDa
Summary This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SNAP29 (NM_004782) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202179L3 Lenti ORF clone of Human synaptosomal-associated protein, 29kDa (SNAP29), Myc-DDK-tagged 10 ug
$600.00
RC202179L4 Lenti ORF clone of Human synaptosomal-associated protein, 29kDa (SNAP29), mGFP tagged 10 ug
$600.00
RG202179 SNAP29 (tGFP-tagged) - Human synaptosomal-associated protein, 29kDa (SNAP29) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117140 SNAP29 (untagged)-Human synaptosomal-associated protein, 29kDa (SNAP29) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.