FKBP7 (NM_181342) Human Tagged ORF Clone

SKU
RC202176
FKBP7 (Myc-DDK-tagged)-Human FK506 binding protein 7 (FKBP7), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FKBP7
Synonyms FKBP23; PPIase
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202176 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAAAACCATGCATTTCTTATTCAGATTCATTGTTTTCTTTTATCTGTGGGGCCTTTTTACTGCTC
AGAGACAAAAGAAAGAGGAGAGCACCGAAGAAGTGAAAATAGAAGTTTTGCATCGTCCAGAAAACTGCTC
TAAGACAAGCAAGAAGGGAGACCTACTAAATGCCCATTATGACGGCTACCTGGCTAAAGACGGCTCGAAA
TTCTACTGCAGCCGGACACAAAATGAAGGCCACCCCAAATGGTTTGTTCTTGGTGTTGGGCAAGTCATAA
AAGGCCTAGACATTGCTATGACAGATATGTGCCCTGGAGAAAAGCGAAAAGTAGTTATACCCCCTTCATT
TGCATACGGAAAGGAAGGCTATGCAGAAGGCAAGATTCCACCGGATGCTACATTGATTTTTGAGATTGAA
CTTTATGCTGTGACCAAAGGACCACGGAGCATTGAGACATTTAAACAAATAGACATGGACAATGACAGGC
AGCTCTCTAAAGCCGAGATAAACCTCTACTTGCAAAGGGAATTTGAAAAAGATGAGAAGCCACGTGACAA
GTCATATCAGGATGCAGTTTTAGAAGATATTTTTAAGAAGAATGACCATGATGGTGATGGCTTCATTTCT
CCCAAGGAATACAATGTATACCAACACGATGAACTA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202176 protein sequence
Red=Cloning site Green=Tags(s)

MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK
FYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIE
LYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFIS
PKEYNVYQHDEL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_181342
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181342.3
RefSeq Size 2904 bp
RefSeq ORF 669 bp
Locus ID 51661
UniProt ID Q9Y680
Cytogenetics 2q31.2
Protein Families Druggable Genome, Transmembrane
MW 25.8 kDa
Summary The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FKBP7 (NM_181342) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202176L1 Lenti ORF clone of Human FK506 binding protein 7 (FKBP7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202176L2 Lenti ORF clone of Human FK506 binding protein 7 (FKBP7), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202176L3 Lenti ORF clone of Human FK506 binding protein 7 (FKBP7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202176L4 Lenti ORF clone of Human FK506 binding protein 7 (FKBP7), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202176 FKBP7 (tGFP-tagged) - Human FK506 binding protein 7 (FKBP7), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC322353 FKBP7 (untagged)-Human FK506 binding protein 7 (FKBP7), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.