EAP30 (SNF8) (NM_007241) Human Tagged ORF Clone

SKU
RC202137
SNF8 (Myc-DDK-tagged)-Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EAP30
Synonyms Dot3; EAP30; VPS22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202137 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAACTTGCAGAGGCCAAGTATAAGGAGC
GAGGGACGGTCTTGGCTGAGGACCAGCTAGCCCAGATGTCAAAGCAGTTGGACATGTTCAAGACCAACCT
GGAGGAATTTGCCAGCAAACACAAGCAGGAGATCCGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGAC
ATGTGTGCAACCATTGGCGTGGATCCGCTGGCCTCTGGAAAAGGATTTTGGTCTGAGATGCTGGGCGTGG
GGGACTTCTATTACGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGG
TCTGATAACTTTGGAGGAACTACATCAACAGGTGTTGAAGGGAAGGGGCAAGTTCGCCCAGGATGTCAGT
CAAGATGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTTGGCACTGGCTTCGGCATCATCCCTGTGG
GCGGCACTTACCTCATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTGCAGCTGGC
AGAGAAGAATGGCTACGTGACTGTCAGTGAGATCAAAGCCAGTCTTAAATGGGAGACCGAGCGAGCGCGG
CAAGTGCTGGAACACCTGCTGAAGGAAGGGTTGGCGTGGCTGGACTTACAGGCCCCAGGGGAGGCCCACT
ACTGGCTGCCAGCTCTCTTCACTGACCTCTACTCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCT
CCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202137 protein sequence
Red=Cloning site Green=Tags(s)

MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD
MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS
QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR
QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007241
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007241.4
RefSeq Size 1226 bp
RefSeq ORF 777 bp
Locus ID 11267
UniProt ID Q96H20
Cytogenetics 17q21.32
Domains EAP30
Protein Families Transcription Factors
Protein Pathways Endocytosis
MW 28.9 kDa
Summary The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:EAP30 (SNF8) (NM_007241) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202137L1 Lenti ORF clone of Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), Myc-DDK-tagged 10 ug
$600.00
RC202137L2 Lenti ORF clone of Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), mGFP tagged 10 ug
$600.00
RC202137L3 Lenti ORF clone of Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), Myc-DDK-tagged 10 ug
$600.00
RC202137L4 Lenti ORF clone of Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), mGFP tagged 10 ug
$600.00
RG202137 SNF8 (tGFP-tagged) - Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115610 SNF8 (untagged)-Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8) 10 ug
$300.00
SC322220 SNF8 (untagged)-Human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.