DUSP11 (NM_003584) Human Tagged ORF Clone

SKU
RC201822
DUSP11 (Myc-DDK-tagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP11
Synonyms PIR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201822 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCAGTGGCATCATCCCCGCAGTGGCTGGGGCCGGAGACGCGACTTTTCAGGACGCTCCTCAGCCA
AGAAGAAGGGCGGAAACCACATCCCCGAAAGGTGGAAAGACTATCTCCCAGTTGGACAGCGGATGCCTGG
GACTCGTTTCATTGCTTTCAAAGTTCCTTTGCAAAAGAGTTTTGAAAAGAAACTTGCTCCAGAAGAATGC
TTTTCCCCTTTGGATCTTTTTAACAAAATCCGAGAACAAAATGAAGAACTTGGACTGATTATTGATTTAA
CATATACTCAACGCTATTATAAACCAGAGGATTTGCCAGAAACTGTTCCTTACTTAAAAATTTTTACAGT
TGGACATCAAGTGCCTGATGATGAGACTATTTTTAAATTCAAACACGCTGTTAATGGGTTTTTGAAAGAA
AATAAAGATAATGATAAACTTATTGGTGTCCACTGTACCCATGGTTTAAACAGGACTGGCTACCTCATTT
GCATATATTTGATTGATGTAGAAGGCGTGAGGCCAGATGATGCAATTGAATTATTCAATAGGTGCCGGGG
ACATTGCTTAGAAAGACAAAACTACATTGAAGACCTTCAGAATGGTCCTATCAGAAAGAATTGGAATTCC
AGTGTACCCAGGTCAAGTGATTTTGAAGACTCAGCACATCTCATGCAACCAGTCCACAATAAGCCTGTTA
AACAAGGACCTAGGTATAATCTACATCAGATCCAGGGTCACTCAGCTCCTCGACATTTCCACACCCAGAC
CCAAAGTTTGCAACAATCAGTCAGAAAATTTTCAGAGAATCCACATGTTTACCAGAGACACCATCTCCCT
CCTCCTGGTCCCCCTGGAGAGGACTATTCACACAGGAGGTATTCTTGGAATGTGAAGCCCAATGCCAGTC
GGGCAGCCCAGGATAGAAGAAGGTGGTATCCTTATAATTACTCCAGACTCTCCTATCCAGCCTGTTGGGA
ATGGACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201822 protein sequence
Red=Cloning site Green=Tags(s)

MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEEC
FSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKE
NKDNDKLIGVHCTHGLNRTGYLICIYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNS
SVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLP
PPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003584
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003584.1, NP_003575.1
RefSeq Size 1639 bp
RefSeq ORF 1134 bp
Locus ID 8446
UniProt ID O75319
Cytogenetics 2p13.1
Domains DSPc
Protein Families Druggable Genome, Phosphatase
MW 38.9 kDa
Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. [provided by RefSeq, Sep 2008]
Write Your Own Review
You're reviewing:DUSP11 (NM_003584) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201822L1 Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), Myc-DDK-tagged 10 ug
$600.00
RC201822L2 Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), mGFP tagged 10 ug
$600.00
RC201822L3 Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), Myc-DDK-tagged 10 ug
$600.00
RC201822L4 Lenti ORF clone of Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11), mGFP tagged 10 ug
$600.00
RG201822 DUSP11 (tGFP-tagged) - Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321328 DUSP11 (untagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11) 10 ug
$300.00
SC327814 DUSP11 (untagged)-Human dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) (DUSP11) 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.