ELAVL1 (NM_001419) Human Tagged ORF Clone

SKU
RC201562
ELAVL1 (Myc-DDK-tagged)-Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ELAVL1
Synonyms ELAV1; Hua; HUR; MelG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201562 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAATGGTTATGAAGACCACATGGCCGAAGACTGCAGGGGTGACATCGGGAGAACGAATTTGATCG
TCAACTACCTCCCTCAGAACATGACCCAGGATGAGTTACGAAGCCTGTTCAGCAGCATTGGTGAAGTTGA
ATCTGCAAAACTTATTCGGGATAAAGTAGCAGGACACAGCTTGGGCTATGGCTTTGTGAACTACGTGACC
GCGAAGGATGCAGAGAGAGCGATCAACACGCTGAACGGCTTGAGGCTCCAGTCAAAAACCATTAAGGTGT
CGTATGCTCGCCCGAGCTCAGAGGTGATCAAAGACGCCAACTTGTACATCAGCGGGCTCCCGCGGACCAT
GACCCAGAAGGACGTAGAAGACATGTTCTCTCGGTTTGGGCGGATCATCAACTCGCGGGTCCTCGTGGAT
CAGACTACAGGTTTGTCCAGAGGGGTTGCGTTTATCCGGTTTGACAAACGGTCGGAGGCAGAAGAGGCAA
TTACCAGTTTCAATGGTCATAAACCCCCAGGTTCCTCTGAGCCCATCACAGTGAAGTTTGCAGCCAACCC
CAACCAGAACAAAAACGTGGCACTCCTCTCGCAGCTGTACCACTCGCCAGCGCGACGGTTCGGAGGCCCC
GTTCACCACCAGGCGCAGAGATTCAGGTTCTCCCCCATGGGCGTCGATCACATGAGCGGGCTCTCTGGCG
TCAACGTGCCAGGAAACGCCTCCTCCGGCTGGTGCATTTTCATCTACAACCTGGGGCAGGATGCCGACGA
GGGGATCCTCTGGCAGATGTTTGGGCCGTTTGGTGCCGTCACCAATGTGAAAGTGATCCGCGACTTCAAC
ACCAACAAGTGCAAAGGGTTTGGCTTTGTGACCATGACAAACTATGAAGAAGCCGCGATGGCCATAGCCA
GCCTGAACGGCTACCGCCTGGGGGACAAAATCTTACAGGTTTCCTTCAAAACCAACAAGTCCCACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201562 protein sequence
Red=Cloning site Green=Tags(s)

MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT
AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP
VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001419
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001419.3
RefSeq Size 6075 bp
RefSeq ORF 981 bp
Locus ID 1994
UniProt ID Q15717
Cytogenetics 19p13.2
Domains RRM
MW 36.1 kDa
Summary The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012]
Write Your Own Review
You're reviewing:ELAVL1 (NM_001419) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201562L1 Lenti ORF clone of Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), Myc-DDK-tagged 10 ug
$600.00
RC201562L2 Lenti ORF clone of Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mGFP tagged 10 ug
$600.00
RC201562L3 Lenti ORF clone of Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), Myc-DDK-tagged 10 ug
$600.00
RC201562L4 Lenti ORF clone of Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mGFP tagged 10 ug
$600.00
RG201562 ELAVL1 (tGFP-tagged) - Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119271 ELAVL1 (untagged)-Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) 10 ug
$300.00
SC322158 ELAVL1 (untagged)-Human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.