CHMP2B (NM_014043) Human Tagged ORF Clone

SKU
RC201532
CHMP2B (Myc-DDK-tagged)-Human chromatin modifying protein 2B (CHMP2B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHMP2B
Synonyms ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201532 representing NM_014043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCCTCTTCAAGAAGAAAACCGTGGATGATGTAATAAAGGAACAGAATCGAGAGTTACGAGGTA
CACAGAGGGCTATAATCAGAGATCGAGCAGCTTTAGAGAAACAAGAAAAACAGCTGGAATTAGAAATTAA
GAAAATGGCCAAGATTGGTAATAAGGAAGCTTGCAAAGTTTTAGCCAAACAACTTGTGCATCTACGGAAA
CAGAAGACGAGAACTTTTGCTGTAAGTTCAAAAGTTACTTCTATGTCTACACAAACAAAAGTGATGAATT
CCCAAATGAAGATGGCTGGAGCAATGTCTACTACAGCAAAAACAATGCAGGCAGTTAACAAGAAGATGGA
TCCACAAAAGACATTACAAACAATGCAGAATTTCCAGAAGGAAAACATGAAAATGGAAATGACTGAAGAA
ATGATCAATGATACACTTGATGACATCTTTGACGGTTCTGATGACGAAGAAGAAAGCCAGGATATTGTGA
ATCAAGTTCTTGATGAAATTGGAATTGAAATTTCTGGAAAGATGGCCAAAGCTCCATCAGCTGCTCGAAG
CTTACCATCTGCCTCTACTTCAAAGGCTACAATCTCAGATGAAGAGATTGAACGGCAACTCAAGGCTTTA
GGAGTAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201532 representing NM_014043
Red=Cloning site Green=Tags(s)

MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK
QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL
GVD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014043
ORF Size 639 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014043.4
RefSeq Size 2410 bp
RefSeq ORF 642 bp
Locus ID 25978
UniProt ID Q9UQN3
Cytogenetics 3p11.2
Domains DUF279
Protein Pathways Endocytosis
MW 23.7 kDa
Summary This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CHMP2B (NM_014043) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201532L1 Lenti-ORF clone of CHMP2B (Myc-DDK-tagged)-Human chromatin modifying protein 2B (CHMP2B) 10 ug
$750.00
RC201532L2 Lenti-ORF clone of CHMP2B (mGFP-tagged)-Human chromatin modifying protein 2B (CHMP2B) 10 ug
$750.00
RC201532L3 Lenti-ORF clone of CHMP2B (Myc-DDK-tagged)-Human chromatin modifying protein 2B (CHMP2B) 10 ug
$750.00
RC201532L4 Lenti-ORF clone of CHMP2B (mGFP-tagged)-Human chromatin modifying protein 2B (CHMP2B) 10 ug
$750.00
RG201532 CHMP2B (tGFP-tagged) - Human chromatin modifying protein 2B (CHMP2B) 10 ug
$650.00
SC115190 CHMP2B (untagged)-Human chromatin modifying protein 2B (CHMP2B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.