NIPSNAP1 (NM_003634) Human Tagged ORF Clone

SKU
RC201270
NIPSNAP1 (Myc-DDK-tagged)-Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NIPSNAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201270 representing NM_003634
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCGCGGCTGTGCAGCATCTCTGTGACGGCGCGGCGGCTGCTGGGGGGCCCGGGGCCTCGCGCTG
GGGACGTTGCGTCTGCAGCTGCGGCGCGTTTCTATTCCAAGGACAATGAAGGCAGCTGGTTCCGCTCCCT
CTTTGTTCACAAAGTGGATCCCCGGAAGGATGCCCACTCCACCCTGCTGTCCAAGAAGGAAACCAGCAAC
CTCTATAAGATCCAGTTTCACAATGTAAAGCCTGAATACCTGGATGCCTACAACAGCCTCACGGAGGCTG
TGCTGCCCAAGCTTCACCTGGATGAGGACTACCCATGCTCACTCGTGGGCAACTGGAACACGTGGTATGG
GGAGCAGGACCAGGCAGTGCACCTGTGGCGATTCTCAGGTGGCTACCCAGCCCTCATGGACTGCATGAAC
AAGCTCAAAAACAATAAGGAGTACCTGGAGTTCCGAAGGGAGCGGAGCCAGATGCTGCTGTCCAGGAGAA
ACCAGCTGCTCCTCGAGTTCAGCTTCTGGAATGAGCCACAGCCCAGAATGGGTCCCAACATCTATGAGCT
GAGGACATACAAGCTCAAGCCAGGAACCATGATCGAGTGGGGGAACAACTGGGCTCGGGCCATCAAGTAC
CGGCAGGAGAACCAGGAGGCAGTGGGCGGCTTCTTCTCACAGATAGGAGAGCTCTACGTGGTGCACCATC
TCTGGGCCTATAAAGACCTGCAGTCTCGGGAGGAGACTCGAAACGCTGCCTGGAGGAAGAGAGGCTGGGA
TGAAAATGTCTACTATACAGTCCCCCTGGTGCGACACATGGAGTCTAGGATCATGATCCCCTTGAAGATC
TCGCCTCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201270 representing NM_003634
Red=Cloning site Green=Tags(s)

MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSN
LYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMN
KLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKY
RQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKI
SPLQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003634
ORF Size 852 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003634.4
RefSeq Size 2233 bp
RefSeq ORF 855 bp
Locus ID 8508
UniProt ID Q9BPW8
Cytogenetics 22q12.2
MW 33.1 kDa
Summary This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. A similar protein in mice inhibits the calcium channel TRPV6, and is also localized to the inner mitochondrial membrane where it may play a role in mitochondrial DNA maintenance. A pseudogene of this gene is located on the short arm of chromosome 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:NIPSNAP1 (NM_003634) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201270L1 Lenti ORF clone of Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201270L2 Lenti ORF clone of Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201270L3 Lenti ORF clone of Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201270L4 Lenti ORF clone of Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201270 NIPSNAP1 (tGFP-tagged) - Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1 10 ug
$500.00
SC117825 NIPSNAP1 (untagged)-Human nipsnap homolog 1 (C. elegans) (NIPSNAP1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.