TRIB2 (NM_021643) Human Tagged ORF Clone

SKU
RC201210
TRIB2 (Myc-DDK-tagged)-Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRIB2
Synonyms C5FW; GS3955; TRB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201210 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATACACAGGTCTACCCCCATCACAATAGCGAGATATGGGAGATCGCGGAACAAAACCCAGGATT
TCGAAGAGTTGTCGTCTATAAGGTCCGCGGAGCCCAGCCAGAGTTTCAGCCCGAACCTCGGCTCCCCGAG
CCCGCCCGAGACTCCGAACTTGTCGCATTGCGTTTCTTGTATCGGGAAATACTTATTGTTGGAACCTCTG
GAGGGAGACCACGTTTTTCGTGCCGTGCATCTGCACAGCGGAGAGGAGCTGGTGTGCAAGGTGTTTGATA
TCAGCTGCTACCAGGAATCCCTGGCACCGTGCTTTTGCCTGTCTGCTCATAGTAACATCAACCAAATCAC
TGAAATTATCCTGGGTGAGACCAAAGCCTATGTGTTCTTTGAGCGAAGCTATGGGGACATGCATTCCTTC
GTCCGCACCTGCAAGAAGCTGAGAGAGGAGGAGGCAGCCAGACTGTTCTACCAGATTGCCTCGGCAGTGG
CCCACTGCCATGACGGGGGGCTGGTGCTGCGGGACCTCAAGCTGCGGAAATTCATCTTTAAGGACGAAGA
GAGGACTCGGGTCAAGCTGGAAAGCCTGGAAGACGCCTACATTCTGCGGGGAGATGATGATTCCCTCTCC
GACAAGCATGGCTGCCCGGCTTACGTAAGCCCAGAGATCTTGAACACCAGTGGCAGCTACTCGGGCAAAG
CAGCCGACGTGTGGAGCCTGGGGGTGATGCTGTACACCATGTTGGTGGGGCGGTACCCTTTCCATGACAT
TGAACCCAGCTCCCTCTTCAGCAAGATCCGGCGTGGCCAGTTCAACATTCCAGAGACTCTGTCGCCCAAG
GCCAAGTGCCTCATCCGAAGCATTCTGCGTCGGGAGCCCTCAGAGCGGCTGACCTCGCAGGAAATTCTGG
ACCATCCTTGGTTTTCTACAGATTTTAGCGTCTCGAATTCAGCATATGGTGCTAAGGAAGTGTCTGACCA
GCTGGTGCCGGACGTCAACATGGAAGAGAACTTGGACCCTTTCTTTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201210 protein sequence
Red=Cloning site Green=Tags(s)

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPL
EGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSF
VRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLS
DKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPK
AKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021643
ORF Size 1029 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021643.3
RefSeq Size 4408 bp
RefSeq ORF 1032 bp
Locus ID 28951
UniProt ID Q92519
Cytogenetics 2p24.3
Domains pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase
MW 38.8 kDa
Summary This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:TRIB2 (NM_021643) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201210L1 Lenti ORF clone of Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201210L2 Lenti ORF clone of Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201210L3 Lenti ORF clone of Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201210L4 Lenti ORF clone of Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201210 TRIB2 (tGFP-tagged) - Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC111247 TRIB2 (untagged)-Human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.