VTI1B (NM_006370) Human Tagged ORF Clone

SKU
RC201172
VTI1B (Myc-DDK-tagged)-Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VTI1B
Synonyms v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201172 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCTCCGCCGCCTCCTCGGAGCATTTCGAGAAGCTGCACGAGATCTTCCGCGGCCTCCATGAAG
ACCTACAAGGGGTGCCCGAGCGGCTGCTGGGGACGGCGGGGACCGAAGAAAAGAAGAAATTGATCAGGGA
TTTTGATGAAAAGCAACAGGAAGCAAATGAAACGCTGGCAGAGATGGAGGAGGAGCTACGTTATGCACCC
CTGTCTTTCCGAAACCCCATGATGTCTAAGCTTCGAAACTACCGGAAGGACCTTGCTAAACTCCATCGGG
AGGTGAGAAGCACACCTTTGACAGCCACACCTGGAGGCCGAGGAGACATGAAATATGGCATATATGCTGT
AGAGAATGAGCATATGAATCGGCTACAGTCTCAAAGGGCAATGCTTCTGCAGGGCACTGAAAGCCTGAAC
CGGGCCACCCAAAGTATTGAACGTTCTCATCGGATTGCCACAGAGACTGACCAGATTGGCTCAGAAATCA
TAGAAGAGCTGGGGGAACAACGAGACCAGTTAGAACGTACCAAGAGTAGACTGGTAAACACAAGTGAAAA
CTTGAGCAAAAGTCGGAAGATTCTCCGTTCAATGTCCAGAAAAGTGACAACCAACAAGCTGCTGCTTTCC
ATTATCATCTTACTGGAGCTCGCCATCCTGGGAGGCCTGGTTTACTACAAATTCTTTCGCAGCCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201172 protein sequence
Red=Cloning site Green=Tags(s)

MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP
LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN
RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS
IIILLELAILGGLVYYKFFRSH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006370
ORF Size 696 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006370.3
RefSeq Size 1357 bp
RefSeq ORF 699 bp
Locus ID 10490
UniProt ID Q9UEU0
Cytogenetics 14q24.1
Domains t_SNARE, V-SNARE
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 26.7 kDa
Summary V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:VTI1B (NM_006370) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201172L3 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), Myc-DDK-tagged 10 ug
$600.00
RC201172L4 Lenti ORF clone of Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), mGFP tagged 10 ug
$600.00
RG201172 VTI1B (tGFP-tagged) - Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116155 VTI1B (untagged)-Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.