EXOSC4 (NM_019037) Human Tagged ORF Clone

SKU
RC201058
EXOSC4 (Myc-DDK-tagged)-Human exosome component 4 (EXOSC4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EXOSC4
Synonyms hRrp41p; p12A; RRP41; RRP41A; Rrp41p; SKI6; Ski6p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201058 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGCTGGAGCTCTTGTCGGACCAGGGCTACCGGGTGGACGGGCGGCGCGCCGGGGAGCTGCGCA
AGATCCAGGCGCGGATGGGCGTGTTCGCGCAGGCTGACGGCTCGGCCTACATTGAGCAGGGCAACACCAA
GGCACTGGCTGTGGTCTACGGCCCGCACGAGATCCGGGGCTCCCGGGCTCGAGCCCTGCCGGACAGGGCC
CTAGTGAACTGTCAATATAGTTCAGCGACCTTCAGCACAGGTGAGCGCAAGCGACGGCCACATGGGGACC
GTAAGTCCTGTGAGATGGGCCTGCAGCTCCGCCAGACTTTCGAAGCAGCCATCCTCACACAGCTGCACCC
ACGCTCCCAGATTGATATCTATGTGCAGGTGCTACAGGCAGATGGTGGGACCTATGCAGCTTGTGTGAAT
GCAGCCACGCTGGCAGTGCTGGATGCCGGGATACCCATGAGAGACTTTGTGTGTGCGTGCTCAGCTGGCT
TCGTGGACGGCACAGCCCTGGCGGACCTCAGCCATGTGGAGGAAGCAGCTGGTGGCCCCCAGCTGGCCCT
GGCCCTGCTGCCAGCCTCAGGACAGATTGCGCTGCTTGAGATGGATGCCCGGCTGCACGAGGACCACCTG
GAGCGGGTGTTGGAGGCTGCTGCCCAGGCTGCCCGAGATGTGCACACCCTCTTAGATCGAGTGGTCCGGC
AGCATGTGCGTGAGGCCTCTATCTTGCTGGGGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201058 protein sequence
Red=Cloning site Green=Tags(s)

MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA
LVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN
AATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHL
ERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019037
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019037.3
RefSeq Size 948 bp
RefSeq ORF 738 bp
Locus ID 54512
UniProt ID Q9NPD3
Cytogenetics 8q24.3
Domains RNase_PH_C
Protein Pathways RNA degradation
MW 26.4 kDa
Summary Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EXOSC4 (NM_019037) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201058L1 Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged 10 ug
$600.00
RC201058L2 Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged 10 ug
$600.00
RC201058L3 Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged 10 ug
$600.00
RC201058L4 Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged 10 ug
$600.00
RG201058 EXOSC4 (tGFP-tagged) - Human exosome component 4 (EXOSC4) 10 ug
$500.00
SC113302 EXOSC4 (untagged)-Human exosome component 4 (EXOSC4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.