EXOSC4 (NM_019037) Human Tagged ORF Clone
SKU
RC201058
EXOSC4 (Myc-DDK-tagged)-Human exosome component 4 (EXOSC4)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | EXOSC4 |
Synonyms | hRrp41p; p12A; RRP41; RRP41A; Rrp41p; SKI6; Ski6p |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC201058 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGGGCTGGAGCTCTTGTCGGACCAGGGCTACCGGGTGGACGGGCGGCGCGCCGGGGAGCTGCGCA AGATCCAGGCGCGGATGGGCGTGTTCGCGCAGGCTGACGGCTCGGCCTACATTGAGCAGGGCAACACCAA GGCACTGGCTGTGGTCTACGGCCCGCACGAGATCCGGGGCTCCCGGGCTCGAGCCCTGCCGGACAGGGCC CTAGTGAACTGTCAATATAGTTCAGCGACCTTCAGCACAGGTGAGCGCAAGCGACGGCCACATGGGGACC GTAAGTCCTGTGAGATGGGCCTGCAGCTCCGCCAGACTTTCGAAGCAGCCATCCTCACACAGCTGCACCC ACGCTCCCAGATTGATATCTATGTGCAGGTGCTACAGGCAGATGGTGGGACCTATGCAGCTTGTGTGAAT GCAGCCACGCTGGCAGTGCTGGATGCCGGGATACCCATGAGAGACTTTGTGTGTGCGTGCTCAGCTGGCT TCGTGGACGGCACAGCCCTGGCGGACCTCAGCCATGTGGAGGAAGCAGCTGGTGGCCCCCAGCTGGCCCT GGCCCTGCTGCCAGCCTCAGGACAGATTGCGCTGCTTGAGATGGATGCCCGGCTGCACGAGGACCACCTG GAGCGGGTGTTGGAGGCTGCTGCCCAGGCTGCCCGAGATGTGCACACCCTCTTAGATCGAGTGGTCCGGC AGCATGTGCGTGAGGCCTCTATCTTGCTGGGGGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201058 protein sequence
Red=Cloning site Green=Tags(s) MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA LVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN AATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHL ERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_019037 |
ORF Size | 735 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_019037.3 |
RefSeq Size | 948 bp |
RefSeq ORF | 738 bp |
Locus ID | 54512 |
UniProt ID | Q9NPD3 |
Cytogenetics | 8q24.3 |
Domains | RNase_PH_C |
Protein Pathways | RNA degradation |
MW | 26.4 kDa |
Summary | Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201058L1 | Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC201058L2 | Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged | 10 ug |
$600.00
|
|
RC201058L3 | Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC201058L4 | Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged | 10 ug |
$600.00
|
|
RG201058 | EXOSC4 (tGFP-tagged) - Human exosome component 4 (EXOSC4) | 10 ug |
$500.00
|
|
SC113302 | EXOSC4 (untagged)-Human exosome component 4 (EXOSC4) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.