JAB1 (COPS5) (NM_006837) Human Tagged ORF Clone

SKU
RC200979
COPS5 (Myc-DDK-tagged)-Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol JAB1
Synonyms CSN5; JAB1; MOV-34; SGN5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200979 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGTCCGGGAGCGGTATGGCCCAGAAAACCTGGGAACTGGCCAACAACATGCAGGAAGCTCAGA
GTATCGATGAAATCTACAAATACGACAAGAAACAGCAGCAAGAAATCCTGGCGGCGAAGCCCTGGACTAA
GGATCACCATTACTTTAAGTACTGCAAAATCTCAGCATTGGCTCTGCTGAAGATGGTGATGCATGCCAGA
TCGGGAGGCAACTTGGAAGTGATGGGTCTGATGCTAGGAAAGGTGGATGGTGAAACCATGATCATTATGG
ACAGTTTTGCTTTGCCTGTGGAGGGCACTGAAACCCGAGTAAATGCTCAGGCTGCTGCATATGAATACAT
GGCTGCATACATAGAAAATGCAAAACAGGTTGGCCGCCTTGAAAATGCAATCGGGTGGTATCATAGCCAC
CCTGGCTATGGCTGCTGGCTTTCTGGGATTGATGTTAGTACTCAGATGCTCAATCAGCAGTTCCAGGAAC
CATTTGTAGCAGTGGTGATTGATCCAACAAGAACAATATCCGCAGGGAAAGTGAATCTTGGCGCCTTTAG
GACATACCCAAAGGGCTACAAACCTCCTGATGAAGGACCTTCTGAGTACCAGACTATTCCACTTAATAAA
ATAGAAGATTTTGGTGTACACTGCAAACAATATTATGCCTTAGAAGTCTCATATTTCAAATCCTCTTTGG
ATCGCAAATTGCTTGAGCTGTTGTGGAATAAATACTGGGTGAATACGTTGAGTTCTTCTAGCTTGCTTAC
TAATGCAGACTATACCACTGGTCAGGTCTTTGATTTGTCTGAAAAGTTAGAGCAGTCAGAAGCCCAGCTG
GGACGAGGGAGTTTCATGTTGGGTTTAGAAACGCATGACCGAAAATCAGAAGACAAACTTGCCAAAGCTA
CAAGAGACAGCTGTAAAACTACCATAGAAGCTATCCATGGATTGATGTCTCAGGTTATTAAGGATAAACT
GTTTAATCAAATTAACATCTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200979 protein sequence
Red=Cloning site Green=Tags(s)

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHAR
SGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSH
PGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNK
IEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL
GRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006837
ORF Size 1002 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006837.3
RefSeq Size 1510 bp
RefSeq ORF 1005 bp
Locus ID 10987
UniProt ID Q92905
Cytogenetics 8q13.1
Domains JAB_MPN
Protein Families Druggable Genome, Protease, Transcription Factors
MW 37.6 kDa
Summary The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:JAB1 (COPS5) (NM_006837) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200979L1 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), Myc-DDK-tagged 10 ug
$757.00
RC200979L2 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), mGFP tagged 10 ug
$757.00
RC200979L3 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), Myc-DDK-tagged 10 ug
$757.00
RC200979L4 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), mGFP tagged 10 ug
$757.00
RG200979 COPS5 (tGFP-tagged) - Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC115830 COPS5 (untagged)-Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5) 10 ug
$457.00
SC320662 COPS5 (untagged)-Human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.