DCUN1D5 (NM_032299) Human Tagged ORF Clone

SKU
RC200870
DCUN1D5 (Myc-DDK-tagged)-Human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DCUN1D5
Synonyms SCCRO5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200870 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGTGAAGAAGAAGAGAAAATCCCCTGGGGTGGCAGCAGCAGTAGCGGAAGACGGAGGCCTCAAAA
AGTGTAAAATCTCCAGCTATTGCAGATCCCAACCCCCTGCTAGACTAATAAGTGGAGAGGAACATTTTTC
AAGCAAGAAGTGCCTGGCTTGGTTTTATGAATATGCAGGTCCTGATGAAGTTGTAGGGCCAGAAGGAATG
GAAAAATTTTGTGAAGACATTGGTGTTGAACCTGAAAATATTATTATGTTAGTTTTAGCGTGGAAATTGG
AGGCTGAAAGCATGGGATTTTTTACCAAGGAAGAATGGTTAAAGGGAATGACTTCATTACAGTGTGACTG
CACAGAAAAGTTACAAAACAAATTTGACTTTTTGCGCTCACAGTTGAATGATATTTCGTCATTTAAGAAT
ATCTACAGATATGCCTTTGATTTTGCAAGGGATAAAGATCAGAGAAGCCTTGATATTGATACTGCTAAAT
CTATGTTAGCTCTTCTGCTTGGGAGGACATGGCCACTGTTTTCAGTATTTTACCAGTACCTGGAGCAATC
AAAGTATCGTGTTATGAACAAAGATCAATGGTACAATGTATTAGAATTCAGCAGAACAGTCCATGCTGAT
CTTAGTAACTATGATGAAGATGGTGCTTGGCCTGTTCTTCTTGATGAATTTGTTGAGTGGCAAAAAGTCC
GTCAGACATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200870 protein sequence
Red=Cloning site Green=Tags(s)

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
LSNYDEDGAWPVLLDEFVEWQKVRQTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032299
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032299.4
RefSeq Size 12732 bp
RefSeq ORF 714 bp
Locus ID 84259
UniProt ID Q9BTE7
Cytogenetics 11q22.3
Domains DUF298
MW 27.5 kDa
Summary Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DCUN1D5 (NM_032299) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200870L3 Lenti ORF clone of Human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), Myc-DDK-tagged 10 ug
$600.00
RC200870L4 Lenti ORF clone of Human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), mGFP tagged 10 ug
$600.00
RG200870 DCUN1D5 (tGFP-tagged) - Human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC105502 DCUN1D5 (untagged)-Human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.