URM1 (NM_030914) Human Tagged ORF Clone

SKU
RC200854
URM1 (Myc-DDK-tagged)-Human ubiquitin related modifier 1 (URM1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol URM1
Synonyms C9orf74
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200854 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGCCCTTGTCAGTGGAGGTGGAGTTCGGAGGTGGTGCGGAGCTCCTGTTTGACGGTATTAAGA
AACATCGAGTCACTTTGCCTGGACAGGAGGAACCCTGGGACATCCGGAACCTGCTCATCTGGATCAAGAA
GAATTTGCTAAAAGAGCGGCCAGAGTTGTTCATCCAGGGAGACAGCGTGCGGCCAGGAATTCTGGTGCTG
ATTAACGATGCCGACTGGGAGCTACTGGGTGAGCTGGACTACCAGCTTCAGGACCAGGACAGCGTCCTCT
TCATCTCCACTCTGCACGGCGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200854 protein sequence
Red=Cloning site Green=Tags(s)

MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL
INDADWELLGELDYQLQDQDSVLFISTLHGG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030914
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030914.4
RefSeq Size 2650 bp
RefSeq ORF 306 bp
Locus ID 81605
UniProt ID Q9BTM9
Cytogenetics 9q34.11
MW 11.4 kDa
Summary Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:URM1 (NM_030914) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200854L3 Lenti ORF clone of Human ubiquitin related modifier 1 (URM1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200854L4 Lenti ORF clone of Human ubiquitin related modifier 1 (URM1), transcript variant 1, mGFP tagged 10 ug
$450.00
RG200854 URM1 (tGFP-tagged) - Human ubiquitin related modifier 1 (URM1), transcript variant 1 10 ug
$489.00
SC122994 URM1 (untagged)-Human ubiquitin related modifier 1 (URM1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.