UBXN1 (NM_015853) Human Tagged ORF Clone

SKU
RC200703
UBXN1 (Myc-DDK-tagged)-Human UBX domain protein 1 (UBXN1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBXN1
Synonyms 2B28; SAKS1; UBXD10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200703 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCTGACGGCTCTTGAGAGTCTCATCGAGATGGGCTTCCCCAGGGGACGCGCGGAGAAGGCTC
TGGCCCTCACAGGGAACCAGGGCATCGAGGCTGCGATGGACTGGCTGATGGAGCACGAAGACGACCCCGA
TGTGGACGAGCCTTTAGAGACTCCCCTTGGACATATCCTGGGACGGGAGCCCACTTCCTCAGAGCAAGGC
GGCCTTGAAGGATCTGGTTCTGCTGCCGGAGAAGGCAAACCCGCTTTGAGTGAAGAGGAAAGACAGGAAC
AAACTAAGAGGATGTTGGAGCTGGTGGCCCAGAAGCAGCGGGAGCGTGAAGAAAGAGAGGAACGGGAGGC
ATTGGAACGGGAACGGCAGCGCAGGAGACAAGGGCAAGAGTTGTCAGCAGCACGACAGCGGCTACAGGAA
GATGAGATGCGCCGGGCTGCTGAGGAGAGGCGGAGGGAAAAGGCCGAGGAGTTAGCAGCCAGACAAAGAG
TTAGAGAAAAGATCGAGAGGGACAAAGCAGAGAGAGCCAAGAAGTATGGTGGCAGTGTGGGCTCTCAGCC
ACCCCCAGTGGCACCAGAGCCAGGTCCTGTTCCCTCTTCTCCCAGCCAGGAGCCTCCCACCAAGCGGGAG
TATGACCAGTGTCGCATACAGGTCAGGCTGCCAGATGGGACCTCACTGACCCAGACGTTCCGGGCCCGGG
AACAGCTGGCAGCTGTGAGGCTCTATGTGGAGCTCCACCGTGGGGAGGAACTAGGTGGGGGCCAGGACCC
TGTGCAATTGCTCAGTGGCTTCCCCAGACGGGCCTTCTCAGAAGCTGACATGGAGCGGCCTCTGCAGGAG
CTGGGTATGGCTGCAAGACTAGAAACCAGGACTAGAAACTGGGGGAGTAGGGAGGCATGCCTAGGAAAAG
GAGGGATGCAAAGAGAAGGGGCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200703 protein sequence
Red=Cloning site Green=Tags(s)

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG
GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQE
DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKRE
YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQE
LGMAARLETRTRNWGSREACLGKGGMQREGAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015853
ORF Size 936 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015853.5
RefSeq Size 1363 bp
RefSeq ORF 939 bp
Locus ID 51035
UniProt ID Q04323
Cytogenetics 11q12.3
Domains UBA, UBX
Protein Families Druggable Genome
MW 35.1 kDa
Summary Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling (PubMed:23545497). Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1 (PubMed:25681446). Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B (PubMed:28152074). Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer (PubMed:20351172). Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:UBXN1 (NM_015853) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200703L1 Lenti ORF clone of Human UBX domain protein 1 (UBXN1), Myc-DDK-tagged 10 ug
$600.00
RC200703L2 Lenti ORF clone of Human UBX domain protein 1 (UBXN1), mGFP tagged 10 ug
$600.00
RC200703L3 Lenti ORF clone of Human UBX domain protein 1 (UBXN1), Myc-DDK-tagged 10 ug
$600.00
RC200703L4 Lenti ORF clone of Human UBX domain protein 1 (UBXN1), mGFP tagged 10 ug
$600.00
RG200703 UBXN1 (tGFP-tagged) - Human UBX domain protein 1 (UBXN1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319056 UBXN1 (untagged)-Human UBX domain protein 1 (UBXN1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.