AK6 (NM_016283) Human Tagged ORF Clone
SKU
RC200412
TAF9 (Myc-DDK-tagged)-Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | AK6 |
Synonyms | AD-004; CGI-137; CINAP; CIP; hCINAP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC200412 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTGCTTCCGAACATCCTGCTCACCGGTACACCAGGGGTTGGAAAAACCACACTAGGCAAAGAACTTG CGTCAAAATCAGGACTGAAATACATTAATGTGGGTGATTTAGCTCGAGAAGAGCAATTGTATGATGGCTA TGATGAAGAGTATGACTGTCCCATTTTAGATGAAGACAGAGTAGTTGATGAGTTAGATAACCAAATGAGA GAAGGTGGAGTTATTGTTGATTACCATGGTTGTGATTTCTTCCCTGAACGCTGGTTTCATATAGTTTTTG TGCTGAGAACAGATACCAATGTATTGTACGAAAGACTTGAAACAAGGGGTTATAATGAGAAGAAACTAAC AGACAATATTCAGTGTGAGATTTTTCAAGTTCTTTATGAAGAAGCCACAGCATCCTACAAGGAAGAAATC GTGCATCAGCTGCCCAGTAATAAACCAGAAGAGCTAGAAAATAATGTAGATCAGATCTTGAAATGGATTG AGCAGTGGATCAAAGATCATAACTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200412 protein sequence
Red=Cloning site Green=Tags(s) MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI VHQLPSNKPEELENNVDQILKWIEQWIKDHNS myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_016283 |
ORF Size | 516 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_016283.5 |
RefSeq Size | 962 bp |
RefSeq ORF | 519 bp |
Locus ID | 102157402 |
UniProt ID | Q9Y3D8 |
Cytogenetics | 5q13.2 |
MW | 20.1 kDa |
Summary | This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC200412L1 | Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC200412L2 | Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RC200412L3 | Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC200412L4 | Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RG200412 | TAF9 (tGFP-tagged) - Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC114379 | TAF9 (untagged)-Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.