AK6 (NM_016283) Human Tagged ORF Clone

SKU
RC200412
TAF9 (Myc-DDK-tagged)-Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AK6
Synonyms AD-004; CGI-137; CINAP; CIP; hCINAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200412 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCTTCCGAACATCCTGCTCACCGGTACACCAGGGGTTGGAAAAACCACACTAGGCAAAGAACTTG
CGTCAAAATCAGGACTGAAATACATTAATGTGGGTGATTTAGCTCGAGAAGAGCAATTGTATGATGGCTA
TGATGAAGAGTATGACTGTCCCATTTTAGATGAAGACAGAGTAGTTGATGAGTTAGATAACCAAATGAGA
GAAGGTGGAGTTATTGTTGATTACCATGGTTGTGATTTCTTCCCTGAACGCTGGTTTCATATAGTTTTTG
TGCTGAGAACAGATACCAATGTATTGTACGAAAGACTTGAAACAAGGGGTTATAATGAGAAGAAACTAAC
AGACAATATTCAGTGTGAGATTTTTCAAGTTCTTTATGAAGAAGCCACAGCATCCTACAAGGAAGAAATC
GTGCATCAGCTGCCCAGTAATAAACCAGAAGAGCTAGAAAATAATGTAGATCAGATCTTGAAATGGATTG
AGCAGTGGATCAAAGATCATAACTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200412 protein sequence
Red=Cloning site Green=Tags(s)

MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR
EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI
VHQLPSNKPEELENNVDQILKWIEQWIKDHNS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016283
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016283.5
RefSeq Size 962 bp
RefSeq ORF 519 bp
Locus ID 102157402
UniProt ID Q9Y3D8
Cytogenetics 5q13.2
MW 20.1 kDa
Summary This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:AK6 (NM_016283) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200412L1 Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200412L2 Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, mGFP tagged 10 ug
$600.00
RC200412L3 Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200412L4 Lenti ORF clone of Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200412 TAF9 (tGFP-tagged) - Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114379 TAF9 (untagged)-Human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.