USP14 (NM_005151) Human Tagged ORF Clone

CAT#: RC200337

Reviews ()
Write a review
  • TrueORF®

USP14 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1



  "NM_005151" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol USP14
Synonyms TGT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200337 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCTCTACTCCGTTACTGTAAAATGGGGAAAGGAGAAATTTGAAGGTGTAGAATTGAATACAGATG
AACCTCCAATGGTATTCAAGGCTCAGCTGTTTGCGTTGACTGGAGTCCAGCCTGCCAGACAGAAAGTTAT
GGTGAAAGGAGGAACGCTAAAGGATGATGATTGGGGAAACATCAAAATAAAAAATGGAATGACTCTACTA
ATGATGGGGTCAGCAGATGCTCTTCCAGAAGAACCCTCAGCCAAAACTGTCTTCGTAGAAGACATGACAG
AAGAACAGTTAGCATCTGCTATGGAGTTACCATGTGGATTGACAAACCTTGGTAACACTTGTTACATGAA
TGCCACAGTTCAGTGTATTCGTTCTGTGCCTGAACTCAAAGATGCCCTTAAAAGGTATGCAGGTGCCTTG
AGAGCTTCAGGGGAAATGGCTTCAGCGCAGTATATTACTGCAGCCCTTAGAGATTTGTTTGATTCCATGG
ATAAAACTTCTTCCAGTATTCCACCTATTATTCTACTGCAGTTTTTGCACATGGCTTTCCCACAGTTTGC
CGAGAAAGGTGAACAAGGACAGTATCTTCAACAGGATGCTAATGAATGTTGGATACAAATGATGCGAGTA
TTGCAACAGAAATTGGAAGCAATAGAGGATGATTCTGTTAAAGAGACAGACTCCTCATCTGCATCGGCAG
CGACACCTTCTAAAAAGAAAAGTTTAATCGATCAGTTCTTCGGTGTTGAGTTTGAAACTACCATGAAATG
TACAGAATCTGAAGAAGAAGAAGTCACCAAAGGAAAGGAAAATCAACTTCAGCTTAGCTGTTTTATCAAT
CAGGAAGTCAAGTATCTTTTTACAGGACTTAAATTGCGACTTCAGGAAGAAATCACCAAACAGTCTCCAA
CGTTGCAAAGAAATGCCTTGTATATCAAATCTTCCAAGATCAGCCGGCTGCCTGCTTACTTGACCATTCA
GATGGTTCGATTTTTTTATAAAGAGAAGGAATCTGTGAATGCCAAAGTTCTTAAGGATGTTAAATTTCCT
CTTATGTTGGATATGTATGAACTGTGTACACCAGAACTTCAAGAGAAAATGGTGTCTTTTCGATCCAAAT
TCAAGGATCTAGAAGATAAAAAAGTGAATCAGCAGCCAAATACAAGTGACAAAAAGAGTAGTCCCCAGAA
AGAAGTTAAGTATGAACCCTTTTCTTTTGCTGATGATATTGGCTCCAATAATTGTGGATACTATGACTTA
CAAGCAGTACTAACACACCAGGGAAGGTCTAGTTCTTCAGGTCATTATGTATCATGGGTGAAAAGGAAAC
AAGATGAATGGATTAAGTTTGATGATGACAAAGTCAGCATCGTAACACCAGAAGATATCTTACGGCTTTC
TGGTGGTGGAGACTGGCATATCGCTTACGTTCTACTCTATGGGCCTCGCAGAGTTGAAATAATGGAAGAG
GAAAGTGAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200337 protein sequence
Red=Cloning site Green=Tags(s)

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL
MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL
RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV
LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN
QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP
LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE
ESEQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005151
ORF Size 1482 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005151.4
RefSeq Size 4156 bp
RefSeq ORF 1485 bp
Locus ID 9097
UniProt ID P54578
Cytogenetics 18p11.32
Domains UBQ, UCH
Protein Families Druggable Genome, Protease
MW 56.1 kDa
Gene Summary This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "USP14"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


USP14 Antibody - C-terminal region
    • 100 ul

USD 475.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.