RAC2 (NM_002872) Human Tagged ORF Clone

SKU
RC200304
RAC2 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAC2
Synonyms EN-7; Gx; HSPC022; IMD73A; IMD73B; IMD73C; p21-Rac2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200304 representing NM_002872.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGATGGGGCCGTGGGCAAGACCTGCCTTCTCATCAGCTAC
ACCACCAACGCCTTTCCCGGAGAGTACATCCCCACCGTGTTTGACAACTATTCAGCCAATGTGATGGTG
GACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCG
CTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAAC
GTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACC
AAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACC
TACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACC
CAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAG
CAGAAGCGCGCCTGCAGCCTCCTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC200304
Blue=ORF Red=Cloning site Green=Tag(s)

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRP
LSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPIT
YPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002872
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002872.5
RefSeq Size 1538 bp
RefSeq ORF 579 bp
Locus ID 5880
UniProt ID P15153
Cytogenetics 22q13.1
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, B cell receptor signaling pathway, Chemokine signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway
MW 21.4 kDa
Summary This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:RAC2 (NM_002872) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200304L1 Lenti-ORF clone of RAC2 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$750.00
RC200304L2 Lenti-ORF clone of RAC2 (mGFP-tagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$750.00
RC200304L3 Lenti-ORF clone of RAC2 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$750.00
RC200304L4 Lenti-ORF clone of RAC2 (mGFP-tagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$750.00
RG200304 RAC2 (tGFP-tagged) - Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC118358 RAC2 (untagged)-Human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) (RAC2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.