OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DKK1 (NM_012242) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200094
DKK1 (Myc-DDK-tagged)-Human dickkopf homolog 1 (Xenopus laevis) (DKK1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA302464 Goat Polyclonal Antibody against DKK1
100 ug
$565.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DKK1 or NM_012242"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DKK1
Synonyms DKK-1; SK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200094 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCTCTGGGCGCAGCGGGAGCTACCCGGGTCTTTGTCGCGATGGTAGCGGCGGCTCTCGGCGGCC
ACCCTCTGCTGGGAGTGAGCGCCACCTTGAACTCGGTTCTCAATTCCAACGCTATCAAGAACCTGCCCCC
ACCGCTGGGCGGCGCTGCGGGGCACCCAGGCTCTGCAGTCAGCGCCGCGCCGGGAATCCTGTACCCGGGC
GGGAATAAGTACCAGACCATTGACAACTACCAGCCGTACCCGTGCGCAGAGGACGAGGAGTGCGGCACTG
ATGAGTACTGCGCTAGTCCCACCCGCGGAGGGGACGCAGGCGTGCAAATCTGTCTCGCCTGCAGGAAGCG
CCGAAAACGCTGCATGCGTCACGCTATGTGCTGCCCCGGGAATTACTGCAAAAATGGAATATGTGTGTCT
TCTGATCAAAATCATTTCCGAGGAGAAATTGAGGAAACCATCACTGAAAGCTTTGGTAATGATCATAGCA
CCTTGGATGGGTATTCCAGAAGAACCACCTTGTCTTCAAAAATGTATCACACCAAAGGACAAGAAGGTTC
TGTTTGTCTCCGGTCATCAGACTGTGCCTCAGGATTGTGTTGTGCTAGACACTTCTGGTCCAAGATCTGT
AAACCTGTCCTGAAAGAAGGTCAAGTGTGTACCAAGCATAGGAGAAAAGGCTCTCATGGACTAGAAATAT
TCCAGCGTTGTTACTGTGGAGAAGGTCTGTCTTGCCGGATACAGAAAGATCACCATCAAGCCAGTAATTC
TTCTAGGCTTCACACTTGTCAGAGACAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200094 protein sequence
Red=Cloning site Green=Tags(s)

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKIC
KPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012242
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012242.4
RefSeq Size 1815 bp
RefSeq ORF 801 bp
Locus ID 22943
UniProt ID O94907
Cytogenetics 10q21.1
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Wnt signaling pathway
MW 28.7 kDa
Summary This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines. provided by RefSeq, Sep 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012242" in other vectors (6)
SKU Description Size Price
RC200094L1 Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), Myc-DDK-tagged 10 ug
$600.00
RC200094L2 Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), mGFP tagged 10 ug
$600.00
RC200094L3 Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), Myc-DDK-tagged 10 ug
$600.00
RC200094L4 Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), mGFP tagged 10 ug
$600.00
RG200094 DKK1 (tGFP-tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1) 10 ug
$489.00 $500.00
SC303946 DKK1 (untagged)-Human dickkopf homolog 1 (Xenopus laevis) (DKK1) 10 ug
$300.00

Plasmid Map for RC200094

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200094
Circular map for RC200094

file-alt Citations

Activation of the Wnt Pathway by Small Peptides: Rational Design, Synthesis and Biological Evaluation
Brogi, Maramai, Brindisi et al
ChemMedChem (2017)
Cited by 15
AI Summary: OriGene’s full-length hDKK1 cDNA was used to generate a stable recombinant DKK1-V5 HEK293 cell line, enabling the study of Wnt pathway activation by small peptides in this research.
Snippet: A stable recombinant DKK1- V5 HEK293 cell line was generated transfecting HEK293 cells (ATCC) with a vector expressing hDKK1 fused with the V5 epi tope obtained by sub cloning hDKK1 full length (OriGene) into the pCDNA6.2 cLumio DEST plasmid (Life Technologies)
Bone Morphogenetic Protein Signaling Suppresses Wound-Induced Skin Repair by Inhibiting Keratinocyte Proliferation and Migration
Lewis, Mardaryev, Poterlowicz et al
J. Invest. Dermatol. (2013)
Cited by 76
AI Summary: OriGene’s mouse monoclonal antibody EPR4759 against the DKK1 (FLAG) epitope was used for Western blot analysis to detect DKK1 expression in skin tissue extracts, contributing to the assessment of molecular changes during wound healing in the study.
Snippet: Western blot analysis of total tissue proteins obtained from the extracts of full-thickness skin of K14-caSmad1 and WT mice was performed using mouse mAb EPR4759 against DKK1 (FLAG) epitope (Origene, Rockville, MD), as previously described (Sharov et al., ... Cite SaveSaving
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products