Pqbp1 (NM_001252528) Mouse Tagged ORF Clone

SKU
MR228871
Pqbp1 (myc-DDK-tagged) - Mouse polyglutamine binding protein 1 (Pqbp1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pqbp1
Synonyms npw38; PQBP-1; Sfc2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR228871 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCTTCCTGTTGCGCTGCAGACCCGCTTGGCGAAGAGGGGCATCCTCAAACATCTGGAGCCGGAGC
CAGAGGAAGAGATTATTGCTGAAGACTACGATGATGATCCTGTTGACTATGAGGCCACCCGGATAGAGGG
TCTGCCACCGAGCTGGTACAAGGTGTTTGACCCTTCTTGCGGACTCCCTTACTATTGGAATGTGGAGACA
GACCTTGTGTCGTGGCTCTCACCACATGATCCTAACTTTGTCGTTACCAAATCCGCCAAGAAAGTCAGGA
ACAATAATGCAGATGCTGAGGACAAGTCGGACCGGAATCTTGAAAAGGTGGACAGAAATCATGAGAAGTC
AGATCGTAGTCATGAGAAGCCAGACAGGAGCCACGAGAAGGCAGACCGAAACCACGAGAAGAATGACAGA
GAACGAGAGCGCAACTACGACAAAGTGGATAGAGAGAGAGATCGGGACAGGGAACGAGAGCGGGCATTTG
ACAAGGCAGACCGGGAAGAGGGCAAAGACCGACGCCACCATCGCAGAGAGGAACTGGCTCCTTACCCCAA
GAACAAGAAAGCGACGAGCCGCAAAGATGAAGAATTAGACCCCATGGACCCCAGCTCATACTCAGATGCA
CCCCGGGGCACATGGTCAACAGGACTCCCCAAGAGGAACGAGGCCAAGACAGGTGCTGACACCACGGCAG
CTGGGCCCCTCTTCCAGCAGCGCCCTTACCCTTCCCCGGGCGCTGTGCTCCGCGCCAATGCAGAAGCCTC
CCGAACCAAACAGCAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR228871 protein sequence
Red=Cloning site Green=Tags(s)

MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSCGLPYYWNVET
DLVSWLSPHDPNFVVTKSAKKVRNNNADAEDKSDRNLEKVDRNHEKSDRSHEKPDRSHEKADRNHEKNDR
ERERNYDKVDRERDRDRERERAFDKADREEGKDRRHHRREELAPYPKNKKATSRKDEELDPMDPSSYSDA
PRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001252528
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001252528.1, NP_001239457.1
RefSeq Size 1053 bp
RefSeq ORF 792 bp
Locus ID 54633
UniProt ID Q91VJ5
Cytogenetics X 3.56 cM
MW 30.6 kDa
Summary Intrinsically disordered protein that acts as a scaffold, and which is involved in different processes, such as pre-mRNA splicing, transcription regulation, innate immunity and neuron development (By similarity). Interacts with splicing-related factors via the intrinsically disordered region and regulates alternative splicing of target pre-mRNA species (PubMed:23512658). May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner (By similarity). Can activate transcription directly or via association with the transcription machinery (By similarity). May be involved in ATXN1 mutant-induced cell death (By similarity). The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit (By similarity). Involved in the assembly of cytoplasmic stress granule, possibly by participating to the transport of neuronal RNA granules (By similarity). Also acts as an innate immune sensor of infection by retroviruses, by detecting the presence of reverse-transcribed DNA in the cytosol (By similarity). Directly binds retroviral reverse-transcribed DNA in the cytosol and interacts with CGAS, leading to activate the cGAS-STING signaling pathway, triggering type-I interferon production (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Pqbp1 (NM_001252528) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC226660 Pqbp1 (untagged) - Mouse polyglutamine binding protein 1 (Pqbp1), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.