Fgf2 (NM_008006) Mouse Tagged ORF Clone

SKU
MR227549
Fgf2 (Myc-DDK-tagged) - Mouse fibroblast growth factor 2 (Fgf2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fgf2
Synonyms bFGF; Fgf-2; Fgfb
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227549 representing NM_008006
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCAGCGGCATCACCTCGCTTCCCGCACTGCCGGAGGACGGCGGCGCCGCCTTCCCACCAGGCC
ACTTCAAGGACCCCAAGCGGCTCTACTGCAAGAACGGCGGCTTCTTCCTGCGCATCCATCCCGACGGCCG
CGTGGATGGCGTCCGCGAGAAGAGCGACCCACACGTCAAACTACAACTCCAAGCAGAAGAGAGAGGAGTT
GTGTCTATCAAGGGAGTGTGTGCCAACCGGTACCTTGCTATGAAGGAAGATGGACGGCTGCTGGCTTCTA
AGTGTGTTACAGAAGAGTGTTTCTTCTTTGAACGACTGGAATCTAATAACTACAATACTTACCGGTCACG
GAAATACTCCAGTTGGTATGTGGCACTGAAACGAACTGGGCAGTATAAACTCGGATCCAAAACGGGACCT
GGACAGAAGGCCATACTGTTTCTTCCAATGTCTGCTAAGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227549 representing NM_008006
Red=Cloning site Green=Tags(s)

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGV
VSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGP
GQKAILFLPMSAKS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008006
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008006.2, NP_032032.1
RefSeq Size 695 bp
RefSeq ORF 465 bp
Locus ID 14173
UniProt ID P15655
Cytogenetics 3 18.41 cM
MW 17.6 kDa
Summary Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fgf2 (NM_008006) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208486 Fgf2 (untagged) - Mouse fibroblast growth factor 2 (Fgf2), (10ug) 10 ug
$225.00
MG227549 Fgf2 (tGFP-tagged) - Mouse fibroblast growth factor 2 (Fgf2), (10ug) 10 ug
$425.00
MR227549L3 Lenti ORF clone of Fgf2 (Myc-DDK-tagged) - Mouse fibroblast growth factor 2 (Fgf2) 10 ug
$525.00
MR227549L4 Lenti ORF clone of Fgf2 (mGFP-tagged) - Mouse fibroblast growth factor 2 (Fgf2) 10 ug
$525.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.