Fxn (NM_008044) Mouse Tagged ORF Clone

SKU
MR224586
Fxn (Myc-DDK-tagged) - Mouse frataxin (Fxn), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fxn
Synonyms FA; FARR; Frda; X25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR224586 representing NM_008044
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGCGTTCGGAGGTCGCGCAGCCGTGGGCTTGCTGCCCCGGACGGCGTCCCGGGCCTCCGCCTGGG
TCGGGAACCCGCGCTGGAGGGAACCGATCGTAACCTGCGGCCGCCGAGGCCTACATGTCACAGTCAACGC
CGGCGCCACCCGCCACGCCCATTTGAACCTCCACTACCTCCAGATTCTGAACATCAAAAAGCAGAGCGTC
TGCGTGGTGCATTTGAGGAACTTGGGGACATTGGACAACCCAAGCTCTCTAGACGAGACAGCGTATGAAA
GACTGGCGGAAGAGACCCTGGACTCCCTGGCCGAGTTCTTTGAAGACCTCGCAGACAAGCCCTATACCCT
GGAGGACTACGATGTCTCTTTTGGGGATGGCGTGCTCACCATTAAGCTGGGCGGGGATCTAGGGACCTAC
GTGATCAACAAGCAGACCCCAAACAAGCAAATCTGGCTGTCTTCTCCTTCCAGCGGCCCCAAGCGCTATG
ACTGGACCGGGAAGAACTGGGTGTACTCTCATGACGGCGTGTCTCTGCATGAGCTGCTGGCCAGGGAGCT
GACTAAAGCTTTAAACACCAAACTGGACTTGTCTTCATTGGCCTATTCTGGAAAAGGCACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR224586 representing NM_008044
Red=Cloning site Green=Tags(s)

MWAFGGRAAVGLLPRTASRASAWVGNPRWREPIVTCGRRGLHVTVNAGATRHAHLNLHYLQILNIKKQSV
CVVHLRNLGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTY
VINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008044
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008044.3
RefSeq Size 1095 bp
RefSeq ORF 624 bp
Locus ID 14297
UniProt ID O35943
Cytogenetics 19 B
MW 23.4 kDa
Summary Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fxn (NM_008044) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208509 Fxn (untagged) - Mouse frataxin (Fxn), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MG224586 Fxn (tGFP-tagged) - Mouse frataxin (Fxn) nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$500.00
MR224586L3 Lenti ORF clone of Fxn (Myc-DDK-tagged) - Mouse frataxin (Fxn), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR224586L4 Lenti ORF clone of Fxn (mGFP-tagged) - Mouse frataxin (Fxn), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.