Rnf152 (NM_178779) Mouse Tagged ORF Clone

SKU
MR223504
Rnf152 (Myc-DDK-tagged) - Mouse ring finger protein 152 (Rnf152), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rnf152
Synonyms A930029B02Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR223504 representing NM_178779
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACACTCTCCCAGGATTCCCTGTTGGAATGTCAGATCTGTTTTAATTATTACAGCCCCCGACGAA
GGCCCAAGTTGTTGGATTGCAAGCACACCTGCTGCTCGGTGTGCCTCCAGCAGATGAGGACCAGCCAGAA
GGACGTAAGGTGCCCCTGGTGCCGTGGCATCACCAAATTGCCCCCGGGCTTCTCTGTATCACAACTGCCC
GATGACCCAGAGGTCTTGGCAGTCATTGCCATACCACACACTTCCGAGCATACCCCAGTCTTCATCAAAC
TTCCAAGCAATGGGTGCTACATGCTGCCCCTGCCCATCTCTAAGGAGCGTACACTCCTGCCGGGAGACAT
GGGCTGCCGCCTGCTGCCAGGGAGCCAGCAGAAGTCTCTCACCGTGGTGACCATCCCTGCAGAACAGCAG
CCCCTGCAGGGTGGAGCTCCCCCGGAGGCTGTGGAGGAGGAGCCTGACAGAAGGGGCGTGGTGAAGAGCT
CCACATGGTCTGGCGTGTGCACTGTCATCCTGGTGGCCTGTGTTTTGGTCTTCCTCCTGGGCATTGTGCT
ACACAACATGTCCTGCATCTCTAAGCGCTTCACTGTGATATCCTGTGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR223504 representing NM_178779
Red=Cloning site Green=Tags(s)

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLP
DDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCRLLPGSQQKSLTVVTIPAEQQ
PLQGGAPPEAVEEEPDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178779
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178779.4, NP_848894.1
RefSeq Size 8529 bp
RefSeq ORF 612 bp
Locus ID 320311
UniProt ID Q8BG47
Cytogenetics 1 E2.1
MW 22.8 kDa
Summary E3 ubiquitin-protein ligase mediating 'Lys-63'-linked polyubiquitination of RRAGA in response to amino acid starvation. Thereby, regulates mTORC1 signaling and plays a role in the cellular response to amino acid availability (PubMed:25936802). Also mediates 'Lys-48'-linked polyubiquitination of target proteins and their subsequent targeting to the proteasome for degradation. Induces apoptosis when overexpressed (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rnf152 (NM_178779) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC214454 Rnf152 (untagged) - Mouse ring finger protein 152 (Rnf152), transcript variant 1, (10ug) 10 ug
$330.00
MG223504 Rnf152 (tGFP-tagged) - Mouse ring finger protein 152 (Rnf152) transcript variant 1, (10ug) 10 ug
$500.00
MR223504L3 Lenti ORF clone of Rnf152 (Myc-DDK-tagged) - Mouse ring finger protein 152 (Rnf152), transcript variant 1 10 ug
$600.00
MR223504L4 Lenti ORF clone of Rnf152 (mGFP-tagged) - Mouse ring finger protein 152 (Rnf152), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.