Calhm1 (NM_001081271) Mouse Tagged ORF Clone

SKU
MR221396
Calhm1 (Myc-DDK-tagged) - Mouse calcium homeostasis modulator 1 (Calhm1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Calhm1
Synonyms EG546729
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR221396 representing NM_001081271
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAAGTTTCGGATGATCTTCCAGTTCTTGCAATCCAACCAAGAGTCCTTCATGAATGGCATCTGTG
GCATCATGGCGCTGGCCAGTGCGCAGATGTATTCTGCCTTTGACTTCAACTGCCCCTGCTTACCCGGCTA
CAACGTGGTCTACAGCCTGGGCATACTGCTGACGCCTCCCCTGGTGCTCTTCCTGCTTGGTCTGGTCATG
AACAACAACATATCCATGCTAGCTGAAGAGTGGAAGCGCCCCGCAGGTCGCCGGGCCAAGGACCCAGCTG
TTCTACGCTACATGTTCTGTTCCATGGCCCAGAGAGCTCTCATCGCCCCTGTCGTCTGGGTGGCTGTCAC
ACTGCTGGATGGCAAGTGCTTTCTCTGTGCCTTCTGCACAGCTGTGCCCGTGGCCACACTAGGCAATGGC
AGCCTGGTGCCGGGCCTGCCTGCTCCAGAACTTGCTCGCCTACTGGCTCGGGTACCCTGCCCTGAGATCT
ATGATGGGAACTGGCTGCTAGCCCGAGAGGTGGCCGTGCGGTATTTGCGCTGCATCTCTCAGGCACTGGG
TTGGTCCTTCGTGCTGCTGACCACATTACTAGCGTTCGTGGTACGCTCTGTGCGTCCCTGCTTCACGCAG
GTCGCCTTTCTCAAGAGCAAGTACTGGTCCCACTACATTGACATTGAGCGCAAGCTCTTCGATGAGACAT
GCACAGAGCATGCCAAAGCCTTTGCTAAGGTATGTATCCAGCAGTTCTTTGAAGCCATGAACCATGACCT
GGAACTGGGTCATACCCACGGAGTACTGGCCACGGCCACAGCCACAGCCACAGCCACAGAGGCTGTCCAA
AGTCCCTCGGACAGGACAGAAGAAGAGAGGGAGAAGTTGCGTGGCATCACTGACCAAGGCACCATGAATA
GGCTACTCACAAGCTGGCACAAATGCAAACCACCACTGAGGCTGGGCCAGGAGGCACCACTGATGAGCAA
CGGCTGGGCTGGGGGCGAGCCCCGGCCTCCACGCAAGGAAGTGGCCACCTACTTCAGCAAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR221396 representing NM_001081271
Red=Cloning site Green=Tags(s)

MDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNVVYSLGILLTPPLVLFLLGLVM
NNNISMLAEEWKRPAGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVATLGNG
SLVPGLPAPELARLLARVPCPEIYDGNWLLAREVAVRYLRCISQALGWSFVLLTTLLAFVVRSVRPCFTQ
VAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGVLATATATATATEAVQ
SPSDRTEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATYFSKV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001081271
ORF Size 1044 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001081271.1, NP_001074740.1
RefSeq Size 1047 bp
RefSeq ORF 1047 bp
Locus ID 546729
UniProt ID D3Z291
Cytogenetics 19 C3
MW 39.3 kDa
Summary Pore-forming subunit of a voltage-gated ion channel required for sensory perception of sweet, bitter and umami tastes. Specifically present in type II taste bud cells, where it plays a central role in sweet, bitter and umami taste perception by inducing ATP release from the cell, ATP acting as a neurotransmitter to activate afferent neural gustatory pathways. Acts both as a voltage-gated and calcium-activated ion channel: mediates neuronal excitability in response to changes in extracellular Ca(2+) concentration. Has poor ion selectivity and forms a wide pore (around 14 Angstroms) that mediates permeation of Ca(2+), Na(+) and K(+), as well as permeation of monovalent anions. Acts as an activator of the ERK1 and ERK2 cascade. Triggers endoplasmic reticulum stress by reducing the calcium content of the endoplasmic reticulum. May indirectly control amyloid precursor protein (APP) proteolysis and aggregated amyloid-beta (Abeta) peptides levels in a Ca(2+) dependent manner.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calhm1 (NM_001081271) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC215147 Calhm1 (untagged) - Mouse calcium homeostasis modulator 1 (Calhm1), (10ug) 10 ug
$686.00
MG221396 Calhm1 (tGFP-tagged) - Mouse calcium homeostasis modulator 1 (Calhm1), (10ug) 10 ug
$886.00
MR221396L3 Lenti ORF clone of Calhm1 (Myc-DDK-tagged) - Mouse calcium homeostasis modulator 1 (Calhm1) 10 ug
$986.00
MR221396L4 Lenti ORF clone of Calhm1 (mGFP-tagged) - Mouse calcium homeostasis modulator 1 (Calhm1) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.