Pnoc (NM_010932) Mouse Tagged ORF Clone

SKU
MR220607
Pnoc (Myc-DDK-tagged) - Mouse prepronociceptin (Pnoc), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pnoc
Synonyms N/O; N/OFQ; N23; Np; Npnc1; OFQ; OFQ/N; p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR220607 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAATCCTCTTTTGTGACGTTCTGCTGCTCAGCCTGCTCTCCAGCGTGTTCAGCAGCTGTCCCAGGG
ACTGCCTCACCTGCCAGGAGAAGCTCCACCCAGCTCCAGACAGCTTCAACTTAAAGACGTGCATCCTCCA
GTGTGAAGAGAAGGTCTTCCCCCGCCCTCTCTGGACTGTATGCACCAAAGTCATGGCCAGTGGCTCCGGG
CAGCTCAGCCCTGCTGACCCAGAGCTTGTGTCAGCTGCTCTTTACCAGCCAAAGGCCTCGGAGATGCAGC
ACCTGAAGAGAATGCCGCGTGTCCGGAGCTTGGTGCAAGTGCGAGATGCAGAGCCTGGCGCAGATGCTGA
GCCTGGCGCAGATGCTGAGCCTGGCGCAGATGACGCTGAGGAGGTGGAGCAGAAGCAGCTGCAGAAAAGG
TTTGGGGGCTTCACCGGGGCCCGGAAATCAGCCCGGAAGTTGGCCAACCAGAAGCGGTTCAGTGAGTTTA
TGAGGCAGTACCTGGTCCTGAGCATGCAGTCAAGTCAACGCCGGCGCACCCTGCACCAGAATGGTAATGT
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR220607 protein sequence
Red=Cloning site Green=Tags(s)

MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSG
QLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKR
FGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010932
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010932.2, NP_035062.1
RefSeq Size 2157 bp
RefSeq ORF 564 bp
Locus ID 18155
UniProt ID Q64387
Cytogenetics 14 D1
MW 20.9 kDa
Summary This gene encodes the precursor for neuropeptides that have been implicated in a wide range of physiological roles such as transmission and sensitivity to pain, learning, memory, anxiety and depression, in the central nervous system. The encoded protein is a precursor that is proteolytically processed to generate multiple biologically active peptides including nociceptin and nocistatin which have opposite functions in pain transmission. Mice lacking the encoded protein display increased anxiety, elevated basal pain threshold and impaired adaptation to repeated stress. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:Pnoc (NM_010932) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209049 Pnoc (untagged) - Mouse prepronociceptin (Pnoc), transcript variant 1, (10ug) 10 ug
$330.00
MG220607 Pnoc (tGFP-tagged) - Mouse prepronociceptin (Pnoc), (10ug) 10 ug
$500.00
MR220607L3 Lenti ORF clone of Pnoc (Myc-DDK-tagged) - Mouse prepronociceptin (Pnoc), transcript variant 1 10 ug
$600.00
MR220607L4 Lenti ORF clone of Pnoc (mGFP-tagged) - Mouse prepronociceptin (Pnoc), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.