Rnf7 (NM_011279) Mouse Tagged ORF Clone
SKU
MR220386
Rnf7 (Myc-DDK-tagged) - Mouse ring finger protein 7 (Rnf7)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Rnf7 |
Synonyms | Rbx2; SAG |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR220386 representing NM_011279
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGACGTGGAGGACGGCGAGGAACCCTGCGTCCTTTCTTCGCACTCCGGGAGCGCAGGCTCCAAGT CGGGAGGCGACAAGATGTTCTCTCTCAAGAAGTGGAACGCGGTAGCCATGTGGAGCTGGGACGTTGAGTG CGATACCTGTGCCATCTGCAGGGTCCAGGTGATGGATGCCTGCCTTCGATGTCAAGCTGAAAACAAGCAA GAGGACTGTGTTGTGGTCTGGGGAGAGTGTAACCATTCCTTCCACAACTGCTGCATGTCCCTGTGGGTGA AACAGAACAATCGCTGCCCTCTGTGCCAGCAGGACTGGGTAGTCCAAAGAATCGGCAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR220386 representing NM_011279
Red=Cloning site Green=Tags(s) MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_011279 |
ORF Size | 339 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_011279.3, NP_035409.1 |
RefSeq Size | 1132 bp |
RefSeq ORF | 342 bp |
Locus ID | 19823 |
UniProt ID | Q9WTZ1 |
Cytogenetics | 9 E3.3 |
MW | 12.7 kDa |
Summary | Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (By similarity). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC209319 | Rnf7 (untagged) - Mouse ring finger protein 7 (Rnf7), (10ug) | 10 ug |
$165.00
|
|
MG220386 | Rnf7 (tGFP-tagged) - Mouse ring finger protein 7 (Rnf7), (10ug) | 10 ug |
$350.00
|
|
MR220386L3 | Lenti ORF clone of Rnf7 (Myc-DDK-tagged) - Mouse ring finger protein 7 (Rnf7) | 10 ug |
$450.00
|
|
MR220386L4 | Lenti ORF clone of Rnf7 (mGFP-tagged) - Mouse ring finger protein 7 (Rnf7) | 10 ug |
$450.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.