Rnf7 (NM_011279) Mouse Tagged ORF Clone

SKU
MG220386
Rnf7 (tGFP-tagged) - Mouse ring finger protein 7 (Rnf7), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rnf7
Synonyms Rbx2; SAG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG220386 representing NM_011279
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACGTGGAGGACGGCGAGGAACCCTGCGTCCTTTCTTCGCACTCCGGGAGCGCAGGCTCCAAGT
CGGGAGGCGACAAGATGTTCTCTCTCAAGAAGTGGAACGCGGTAGCCATGTGGAGCTGGGACGTTGAGTG
CGATACCTGTGCCATCTGCAGGGTCCAGGTGATGGATGCCTGCCTTCGATGTCAAGCTGAAAACAAGCAA
GAGGACTGTGTTGTGGTCTGGGGAGAGTGTAACCATTCCTTCCACAACTGCTGCATGTCCCTGTGGGTGA
AACAGAACAATCGCTGCCCTCTGTGCCAGCAGGACTGGGTAGTCCAAAGAATCGGCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG220386 representing NM_011279
Red=Cloning site Green=Tags(s)

MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ
EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011279
ORF Size 339 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011279.3, NP_035409.1
RefSeq Size 1132 bp
RefSeq ORF 342 bp
Locus ID 19823
UniProt ID Q9WTZ1
Cytogenetics 9 E3.3
Summary Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (By similarity). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rnf7 (NM_011279) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209319 Rnf7 (untagged) - Mouse ring finger protein 7 (Rnf7), (10ug) 10 ug
$165.00
MR220386 Rnf7 (Myc-DDK-tagged) - Mouse ring finger protein 7 (Rnf7) 10 ug
$289.00
MR220386L3 Lenti ORF clone of Rnf7 (Myc-DDK-tagged) - Mouse ring finger protein 7 (Rnf7) 10 ug
$450.00
MR220386L4 Lenti ORF clone of Rnf7 (mGFP-tagged) - Mouse ring finger protein 7 (Rnf7) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.